Help  Custom Search
 
Heat shock protein beta-6 of Rattus norvegicus

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein beta-6

Synonymous Names

HSPB6_RAT, HSP20

Taxon Information

Organism

Rattus norvegicus

Organism ID

10116 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MEIRVPVQPSWLRRASAPLPGFSTPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVPTD PGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEG VLSIQATPASAQASLPSPPAAK

FASTA Format Composition Secondary Structure

Nucleotide
 GCAGGATGGAGATCCGGGTGCCTGTGCAGCCTTCTTGGCTGCGCCGTGCTTCAGCTCCTTTACCGGGTTTTTCCACTCCGGGACGCCTC
TTTGACCAGCGTTTCGGCGAAGGGCTGCTTGAGGCAGAGCTGGCTTCACTGTGCCCTGCTGCGATCGCGCCCTACTATCTGCGCGCCCCC
AGTGTGGCGTTACCCACAGCCCAGGTGCCCACGGACCCTGGGTATTTTTCTGTGCTGCTGGATGTGAAGCACTTCTCGCCAGAGGAAATC
TCTGTCAAGGTGGTTGGTGACCATGTGGAGGTCCATGCTCGGCATGAGGAGCGCCCAGATGAACATGGATTCATTGCTCGAGAGTTCCAC
CGCCGATACCGCCTGCCTCCTGGCGTGGACCCTGCTGCAGTGACCTCTGCACTGTCTCCTGAGGGTGTTCTGTCTATCCAGGCCACACCA
GCGTCGGCCCAGGCCTCACTTCCGTCACCACCTGCTGCCAAGTAGGGGTCCCAGCATTACAGGACCGAACCGGGAAGCCTCTTTAGGCTC
CCTTTTAAAATGCCGATCTGACTCCACTGCCCAGCCAGATGTCCCAATCGCTGTCAAGACAGCCTTTCCCAACCACAACTAGATGTCCTC
CCCTGAGACCTTCCCAACCCAAACCCTACCTGAGCCTTAGTGACCTAGACACCCTTCCTAAGCCCTCTCCCAGCTTTCAGGCCCCACCCA
TGACATCTCTCTAGAGGCAACACAAACACTACTGTCAGGAGCCAAGGCTCCCATCAGACTGACCCCACTTTGGGCTTCTCTCACACTCAG
GCTGCATTTGTGAGCTGTAGAACACCCCACCGTGACAGCAGAGTACAATGTAGTCAGCGCTCCCCTCCTTCCAATCCTGTCACCTAATTC
CCCACAGTGATGTAGACTGCATAGGCTTTCCACACCAGAACGCTCAAGCCTGGTCCACCAGACTCCAGTCTCTGTAACCTAACACTCCTC
TGCCCCAGCCCACTGTCTGACTTAAAACTCCAGGCACCGAAATTCTTGAATACTATTCTGACCTCCAATTCTTGGGACTCCTATTCCTGA
CAAACCAGGAACCCCAAACTCAAATTGTATGGACACTCCACCTTCTCCAGATGTGCTAGACCAATGAACAAGAACCTGTGAGCTCTCTGT
CCTGGCTCCCCATCTGCAGTCAGATGTCTTAGGGAGCCCGCTCCACATCTGCCATCCTCTAAGGTTGCACCTTCACTCTGAACATTTCCT
GTCTCCCCAGGCCTTCCTGCCATTAGTTCCCAATAAATGCACTTGAGATTT 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine27421 %
Guanine28022 %
Thyamine31024 %
Cytosine44635 %
A+T58445 %
G+C72656 %

Total Bases :   1310 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC16923
TCTCTC72423
TCTCTC79523
CTCTCT116123

Microsatellite Map

GCAGGATGGAGATCCGGGTGCCTGTGCAGCCTTCTTGGCTGCGCCGTGCTTCAGCTCCTTTACCGGGTTTTTCCACTCCGGGACGCCTCT
TTGACCAGCGTTTCGGCGAAGGGCTGCTTGAGGCAGAGCTGGCTTCACTGTGCCCTGCTGCGATCGCGCCCTACTATCTGCGCGCCCCCA
GTGTGGCGTTACCCACAGCCCAGGTGCCCACGGACCCTGGGTATTTTTCTGTGCTGCTGGATGTGAAGCACTTCTCGCCAGAGGAAATCT
CTGTCAAGGTGGTTGGTGACCATGTGGAGGTCCATGCTCGGCATGAGGAGCGCCCAGATGAACATGGATTCATTGCTCGAGAGTTCCACC
GCCGATACCGCCTGCCTCCTGGCGTGGACCCTGCTGCAGTGACCTCTGCACTGTCTCCTGAGGGTGTTCTGTCTATCCAGGCCACACCAG
CGTCGGCCCAGGCCTCACTTCCGTCACCACCTGCTGCCAAGTAGGGGTCCCAGCATTACAGGACCGAACCGGGAAGCCTCTTTAGGCTCC
CTTTTAAAATGCCGATCTGACTCCACTGCCCAGCCAGATGTCCCAATCGCTGTCAAGACAGCCTTTCCCAACCACAACTAGATGTCCTCC
CCTGAGACCTTCCCAACCCAAACCCTACCTGAGCCTTAGTGACCTAGACACCCTTCCTAAGCCCTCTCCCAGCTTTCAGGCCCCACCCAT
GACATCTCTCTAGAGGCAACACAAACACTACTGTCAGGAGCCAAGGCTCCCATCAGACTGACCCCACTTTGGGCTTCTCTCACACTCAGG
CTGCATTTGTGAGCTGTAGAACACCCCACCGTGACAGCAGAGTACAATGTAGTCAGCGCTCCCCTCCTTCCAATCCTGTCACCTAATTCC
CCACAGTGATGTAGACTGCATAGGCTTTCCACACCAGAACGCTCAAGCCTGGTCCACCAGACTCCAGTCTCTGTAACCTAACACTCCTCT
GCCCCAGCCCACTGTCTGACTTAAAACTCCAGGCACCGAAATTCTTGAATACTATTCTGACCTCCAATTCTTGGGACTCCTATTCCTGAC
AAACCAGGAACCCCAAACTCAAATTGTATGGACACTCCACCTTCTCCAGATGTGCTAGACCAATGAACAAGAACCTGTGAGCTCTCTGTC
CTGGCTCCCCATCTGCAGTCAGATGTCTTAGGGAGCCCGCTCCACATCTGCCATCCTCTAAGGTTGCACCTTCACTCTGAACATTTCCTG
TCTCCCCAGGCCTTCCTGCCATTAGTTCCCAATAAATGCACTTGAGATTT

Gene Information
Molecule Type mRNA
Bases 1310 Bases
Molecular Weight401212.66 Da
Coding Sequence 6..494
NCBI ReferenceNM_138887
Notes Rattus norvegicus heat shock protein; alpha-crystallin-related; B6(Hspb6); mRNA. heatshockproteinbeta-6

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Crystallin 1 to 64 64 Alpha crystallin A chain, N terminal PF00525
sHsp 66 to 158 97 Alpha-crystallin domain PF00011

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2WJ5 Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_RANO10

Accession Number

sHsp_1288

Added on

2012-02-02

Updated On

2014-01-20