Help  Custom Search
 
alpha-crystallin B chain of Homo sapiens

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

alpha-crystallin B chain

Synonymous Names

CRYAB_HUMAN, HSP20

Taxon Information

Organism

Homo sapiens

Organism ID

9606 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo sapiens

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRL EKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSD GVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

FASTA Format Composition Secondary Structure

Nucleotide
 GACCCCTCACACTCACCTAGCCACCATGGACATCGCCATCCACCACCCCTGGATCCGCCGCCCCTTCTTTCCTTTCCACTCCCCCAGCC
GCCTCTTTGACCAGTTCTTCGGAGAGCACCTGTTGGAGTCTGATCTTTTCCCGACGTCTACTTCCCTGAGTCCCTTCTACCTTCGGCCAC
CCTCCTTCCTGCGGGCACCCAGCTGGTTTGACACTGGACTCTCAGAGATGCGCCTGGAGAAGGACAGGTTCTCTGTCAACCTGGATGTGA
AGCACTTCTCCCCAGAGGAACTCAAAGTTAAGGTGTTGGGAGATGTGATTGAGGTGCATGGAAAACATGAAGAGCGCCAGGATGAACATG
GTTTCATCTCCAGGGAGTTCCACAGGAAATACCGGATCCCAGCTGATGTAGACCCTCTCACCATTACTTCATCCCTGTCATCTGATGGGG
TCCTCACTGTGAATGGACCAAGGAAACAGGTCTCTGGCCCTGAGCGCACCATTCCCATCACCCGTGAAGAGAAGCCTGCTGTCACCGCAG
CCCCCAAGAAATAGATGCCCTTTCTTGAATTGCATTTTTTAAAACAAGAAAGTTTCCCCACCAGTGAATGAAAGTCTTGTGACTAGTGCT
GAAGCTTATTAATGCTAAGGGCAGGCCCAAATTATCAAGCTAATAAAATATCATTCAGCAAC 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine16825 %
Guanine14822 %
Thyamine16725 %
Cytosine20831 %
A+T33549 %
G+C35652 %

Total Bases :   691 bases

Microsatellites
SequencePosition LengthRepeats
TTTTTT57323

Microsatellite Map

GACCCCTCACACTCACCTAGCCACCATGGACATCGCCATCCACCACCCCTGGATCCGCCGCCCCTTCTTTCCTTTCCACTCCCCCAGCCG
CCTCTTTGACCAGTTCTTCGGAGAGCACCTGTTGGAGTCTGATCTTTTCCCGACGTCTACTTCCCTGAGTCCCTTCTACCTTCGGCCACC
CTCCTTCCTGCGGGCACCCAGCTGGTTTGACACTGGACTCTCAGAGATGCGCCTGGAGAAGGACAGGTTCTCTGTCAACCTGGATGTGAA
GCACTTCTCCCCAGAGGAACTCAAAGTTAAGGTGTTGGGAGATGTGATTGAGGTGCATGGAAAACATGAAGAGCGCCAGGATGAACATGG
TTTCATCTCCAGGGAGTTCCACAGGAAATACCGGATCCCAGCTGATGTAGACCCTCTCACCATTACTTCATCCCTGTCATCTGATGGGGT
CCTCACTGTGAATGGACCAAGGAAACAGGTCTCTGGCCCTGAGCGCACCATTCCCATCACCCGTGAAGAGAAGCCTGCTGTCACCGCAGC
CCCCAAGAAATAGATGCCCTTTCTTGAATTGCATTTTTTAAAACAAGAAAGTTTCCCCACCAGTGAATGAAAGTCTTGTGACTAGTGCTG
AAGCTTATTAATGCTAAGGGCAGGCCCAAATTATCAAGCTAATAAAATATCATTCAGCAAC

Gene Information
Molecule Type mRNA
Bases 691 Bases
Molecular Weight212231.24 Da
Coding Sequence 26..553
NCBI ReferenceNM_001885
Notes Homo sapiens crystallin; alpha B (CRYAB); mRNA. alpha-crystallinBchain

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 67 to 162 95 Alpha-crystallin domain PF00011
Crystallin 1 to 59 59 Alpha crystallin A chain, N terminal PF00525

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_HOSA2

Accession Number

sHsp_1184

Added on

2012-02-02

Updated On

2014-01-20