Help  Custom Search
 
Alpha-crystallin A chain of Bos taurus

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Alpha-crystallin A chain

Synonymous Names

CRYAA_BOVIN, HSP20

Taxon Information

Organism

Bos taurus

Organism ID

9913 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos; Bos taurus

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MDIAIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDK FVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLT FSGPKIPSGVDAGHSERAIPVSREEKPSSAPSS

FASTA Format Composition Secondary Structure

Nucleotide
 CCCCGGGTGCCCACAGAGCCGCTGCCCACCATGGATATCGCCATTCAGCACCCCTGGTTCAAACGCACCCTGGGCCCCTTCTACCCCAG
CCGGCTGTTCGACCAGTTCTTCGGCGAGGGCCTCTTCGAGTACGACCTGCTGCCCTTCCTGTCCTCCACCATCAGCCCCTACTACCGCCA
GTCCCTCTTCCGCACCGTGCTGGACTCCGGCATCTCTGAGGTCCGATCCGACCGGGACAAGTTTGTCATCTTCCTGGATGTGAAGCACTT
CTCTCCCGAGGACCTGACGGTGAAGGTGCAGGAGGACTTCGTGGAGATCCACGGCAAGCACAACGAGCGGCAGGATGACCATGGCTACAT
CTCCCGCGAGTTCCACCGCCGCTACCGCCTGCCTTCCAACGTGGACCAGTCCGCACTCTCCTGCTCCCTGTCCGCTGATGGCATGCTGAC
CTTCTCTGGCCCCAAGATCCCATCTGGCGTGGACGCCGGCCACAGCGAGCGGGCCATCCCCGTGTCCCGGGAGGAGAAGCCCAGCTCTGC
GCCCTCGTCCTAAGCTCGGCCTTGGCCTCGGCTGCCACCCGCTGCGGCCCCCGTACCCATCCATCTGGGGGACCCTAGAAAGTGGGGCAT
CCATCTCCCTCTGCTTCCCCCCTTTCCAGTTCCTTTTCCTCTTCTTCGAGGGCTTGAGGGTTTGAGAGAGTAGCCGGGAGGCCCAGGGCC
AGCCTGTGGTGCAAAGACCTCAGAGTGACCCGGGTCCCAACACCAGCCCCTCGGGGGAAGTGACCACTGTCGGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine12917 %
Guanine21127 %
Thyamine15620 %
Cytosine29738 %
A+T28536 %
G+C50865 %

Total Bases :   793 bases

Microsatellites
SequencePosition LengthRepeats
TCTCTC26823
CCCCCC64523
GAGAGA69223

Microsatellite Map

CCCCGGGTGCCCACAGAGCCGCTGCCCACCATGGATATCGCCATTCAGCACCCCTGGTTCAAACGCACCCTGGGCCCCTTCTACCCCAGC
CGGCTGTTCGACCAGTTCTTCGGCGAGGGCCTCTTCGAGTACGACCTGCTGCCCTTCCTGTCCTCCACCATCAGCCCCTACTACCGCCAG
TCCCTCTTCCGCACCGTGCTGGACTCCGGCATCTCTGAGGTCCGATCCGACCGGGACAAGTTTGTCATCTTCCTGGATGTGAAGCACTTC
TCTCCCGAGGACCTGACGGTGAAGGTGCAGGAGGACTTCGTGGAGATCCACGGCAAGCACAACGAGCGGCAGGATGACCATGGCTACATC
TCCCGCGAGTTCCACCGCCGCTACCGCCTGCCTTCCAACGTGGACCAGTCCGCACTCTCCTGCTCCCTGTCCGCTGATGGCATGCTGACC
TTCTCTGGCCCCAAGATCCCATCTGGCGTGGACGCCGGCCACAGCGAGCGGGCCATCCCCGTGTCCCGGGAGGAGAAGCCCAGCTCTGCG
CCCTCGTCCTAAGCTCGGCCTTGGCCTCGGCTGCCACCCGCTGCGGCCCCCGTACCCATCCATCTGGGGGACCCTAGAAAGTGGGGCATC
CATCTCCCTCTGCTTCCCCCCTTTCCAGTTCCTTTTCCTCTTCTTCGAGGGCTTGAGGGTTTGAGAGAGTAGCCGGGAGGCCCAGGGCCA
GCCTGTGGTGCAAAGACCTCAGAGTGACCCGGGTCCCAACACCAGCCCCTCGGGGGAAGTGACCACTGTCGGA

Gene Information
Molecule Type mRNA
Bases 793 Bases
Molecular Weight243147.1 Da
Coding Sequence 31..552
NCBI ReferenceNM_174289
Notes Bos taurus crystallin; alpha A (CRYAA); mRNA. alpha-crystallinAchain

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Crystallin 1 to 56 56 Alpha crystallin A chain, N terminal PF00525
sHsp 63 to 162 100 Alpha-crystallin domain PF00011

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

3L1E Jmol
3L1F Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_BOTA4

Accession Number

sHsp_1023

Added on

2012-02-02

Updated On

2014-01-20