Help  Custom Search
 
16.9 kDa class I heat shock protein 2 of Triticum aestivum

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

16.9 kDa class I heat shock protein 2

Synonymous Names

HS16B_WHEAT, HSP20

Taxon Information

Organism

Triticum aestivum

Organism ID

4565 [NCBI] [UNIPROT]

Lineage

Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Liliopsida; commelinids; Poales; Poaceae; BEP clade; Pooideae; Triticeae; Triticum

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MSIVRRTNVFDPFADLWADPFDTFRSIVPAISGGGSETAAFANARMDWKETPEAHVFKADLPGVKKEEVK VEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEVK KPEVKAIQISG

FASTA Format Composition Secondary Structure


			

Download Fasta Sequence


DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 47 to 150 103 Alpha-crystallin domain PF00011

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

1GME Jmol
2H50 Jmol
2H53 Jmol
2BYU Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_TRAE1

Accession Number

sHsp_0771

Added on

2012-02-02

Updated On

2012-07-27