Help  Custom Search
 
heat shock protein Hsp20 of Anabaena variabilis str. ATCC 29413

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein Hsp20

Synonymous Names

Q3M8K1_ANAVT, HSP20

Taxon Information

Organism

Anabaena variabilis str. ATCC 29413

Organism ID

240292 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena; Anabaena variabilis ATCC 29413

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MMRTNERLKPGSDSQENLRGVKDMTIIRWNPWQDLNTLQRQLNHLFEEDMLPSTVLERTLTRVPAAEIHE TAEAIHLKLELPGIDAKDVDLQVTDKAVYISGERKSETKTEDKGVVKSEFQYGKFQRVIPLPTRIQNTNV KAEYKDGILNLTLPKAEAEKNKVVKVNIESAVG

FASTA Format Composition Secondary Structure

Nucleotide
 ATGATGAGAACAAATGAAAGATTAAAGCCTGGAAGCGATTCGCAGGAAAACCTTAGAGGAGTCAAAGATATGACAATTATTCGTTGGAA
CCCTTGGCAAGATTTAAATACTTTACAACGTCAATTAAATCATTTGTTTGAGGAAGATATGCTACCATCTACAGTATTAGAAAGAACCCT
AACTAGAGTTCCGGCTGCTGAAATACATGAAACAGCAGAAGCAATTCATCTAAAACTAGAACTTCCTGGAATTGATGCTAAAGATGTAGA
TTTACAAGTCACTGACAAAGCAGTTTATATTAGTGGCGAACGTAAATCTGAAACTAAGACGGAAGATAAGGGTGTTGTCAAAAGCGAATT
CCAATATGGCAAATTCCAACGCGTAATCCCTTTACCCACACGTATTCAAAATACCAACGTCAAGGCAGAATATAAAGATGGTATCTTGAA
TTTGACATTACCTAAAGCCGAAGCAGAAAAGAATAAAGTCGTGAAGGTTAACATTGAATCTGCTGTTGGCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine19939 %
Guanine10320 %
Thyamine13126 %
Cytosine8918 %
A+T33064 %
G+C19237 %

Total Bases :   522 bases

Microsatellites
SequencePosition LengthRepeats

Microsatellite Map

ATGATGAGAACAAATGAAAGATTAAAGCCTGGAAGCGATTCGCAGGAAAACCTTAGAGGAGTCAAAGATATGACAATTATTCGTTGGAAC
CCTTGGCAAGATTTAAATACTTTACAACGTCAATTAAATCATTTGTTTGAGGAAGATATGCTACCATCTACAGTATTAGAAAGAACCCTA
ACTAGAGTTCCGGCTGCTGAAATACATGAAACAGCAGAAGCAATTCATCTAAAACTAGAACTTCCTGGAATTGATGCTAAAGATGTAGAT
TTACAAGTCACTGACAAAGCAGTTTATATTAGTGGCGAACGTAAATCTGAAACTAAGACGGAAGATAAGGGTGTTGTCAAAAGCGAATTC
CAATATGGCAAATTCCAACGCGTAATCCCTTTACCCACACGTATTCAAAATACCAACGTCAAGGCAGAATATAAAGATGGTATCTTGAAT
TTGACATTACCTAAAGCCGAAGCAGAAAAGAATAAAGTCGTGAAGGTTAACATTGAATCTGCTGTTGGCTAA

Gene Information
Molecule Type genomic DNA
Bases 522 Bases
Molecular Weight161762.68 Da
Coding Sequence complement(CP000117.1:3815270..3815791)
NCBI ReferenceABA22685
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 67 to 169 102 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_ANVA2

Accession Number

sHsp_0025

Added on

2012-02-02

Updated On

2014-01-20