Help  Custom Search
 
small heat shock protein of Agrobacterium vitis str. S4

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

small heat shock protein

Synonymous Names

B9JZK1_AGRVS, HSP20

Taxon Information

Organism

Agrobacterium vitis str. S4

Organism ID

311402 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium vitis S4

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MRRTKSITTPLLLGFDITDAVLSQLARTSDGYPPYNIELVRRTSDHEGDRLRITLAVAGFSESDLEVLVE GNQLIIRGSQTERPDADYLFRGIAARNFQRSFLLTDGMDVSRARMRNGLLVVELIRPDTQQMVRKINISA SD

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCGACGGACAAAATCCATCACCACACCCCTGCTGCTGGGTTTCGACATTACCGATGCCGTGTTGAGTCAGTTGGCCCGGACCAGCGA
CGGCTATCCGCCCTATAATATCGAGCTTGTTCGCCGCACGAGCGACCATGAAGGGGACCGGTTGCGGATTACCCTTGCCGTGGCGGGCTT
TTCCGAGAGCGATCTGGAGGTTCTGGTCGAGGGAAACCAGCTGATCATTCGAGGCTCCCAGACGGAACGCCCGGATGCCGATTATTTGTT
TCGCGGCATAGCTGCACGGAACTTTCAGCGCAGTTTCCTGTTAACGGACGGAATGGACGTTTCGCGCGCACGGATGCGAAACGGCCTACT
GGTGGTCGAACTAATTCGTCCTGATACGCAGCAAATGGTAAGGAAAATTAATATTTCCGCCTCAGACTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine9523 %
Guanine12229 %
Thyamine9623 %
Cytosine11628 %
A+T19145 %
G+C23856 %

Total Bases :   429 bases

Microsatellites
SequencePosition LengthRepeats
CTGCTGCTG3033
CGCGCG33123

Microsatellite Map

ATGCGACGGACAAAATCCATCACCACACCCCTGCTGCTGGGTTTCGACATTACCGATGCCGTGTTGAGTCAGTTGGCCCGGACCAGCGAC
GGCTATCCGCCCTATAATATCGAGCTTGTTCGCCGCACGAGCGACCATGAAGGGGACCGGTTGCGGATTACCCTTGCCGTGGCGGGCTTT
TCCGAGAGCGATCTGGAGGTTCTGGTCGAGGGAAACCAGCTGATCATTCGAGGCTCCCAGACGGAACGCCCGGATGCCGATTATTTGTTT
CGCGGCATAGCTGCACGGAACTTTCAGCGCAGTTTCCTGTTAACGGACGGAATGGACGTTTCGCGCGCACGGATGCGAAACGGCCTACTG
GTGGTCGAACTAATTCGTCCTGATACGCAGCAAATGGTAAGGAAAATTAATATTTCCGCCTCAGACTAG

Gene Information
Molecule Type genomic DNA
Bases 429 Bases
Molecular Weight132604.69 Da
Coding Sequence complement(CP000633.1:381279..381707)
NCBI ReferenceACM35313
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 13 to 139 126 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_AGVI2

Accession Number

sHsp_0023

Added on

2012-02-02

Updated On

2014-01-20