Help  Custom Search
 
small heat shock protein of Agrobacterium vitis str. S4

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

small heat shock protein

Synonymous Names

B9JS60_AGRVS, HSP20

Taxon Information

Organism

Agrobacterium vitis str. S4

Organism ID

311402 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium vitis S4

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MRHVDFSPLYRSTVGFDRLFTMLDSLGQPDQAQSYPPYNIERTGDNTYRITMAVAGFDETELSIEAHAHV LAVKGEKAQEDQAEQTEFLYRGIAKRGFERRFQLADHVEVTNASLKNGLLHIDLLRNIPEAMKPRRIAIA SEPVEAPKAIESRVV

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCGTCACGTTGATTTTTCCCCGCTCTATCGCTCCACCGTCGGCTTCGACCGCCTGTTCACCATGTTGGACAGCCTGGGTCAGCCGGA
TCAGGCCCAGAGCTATCCGCCCTATAATATCGAGCGGACGGGCGACAATACCTACCGGATCACCATGGCCGTTGCCGGCTTCGATGAAAC
CGAACTCAGCATCGAGGCCCATGCGCATGTGCTGGCGGTCAAGGGTGAGAAAGCCCAGGAAGACCAGGCCGAACAGACCGAGTTTCTGTA
TCGCGGCATTGCCAAGCGCGGGTTCGAGCGTCGTTTCCAGCTTGCCGACCATGTCGAGGTGACCAATGCCTCGCTGAAGAACGGCCTGCT
GCATATCGATCTGCTGCGCAATATTCCCGAAGCCATGAAGCCGCGCCGCATCGCCATTGCCAGCGAACCGGTCGAGGCGCCCAAGGCGAT
TGAGTCTCGCGTCGTCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine9521 %
Guanine13329 %
Thyamine9220 %
Cytosine14832 %
A+T18740 %
G+C28161 %

Total Bases :   468 bases

Microsatellites
SequencePosition LengthRepeats

Microsatellite Map

ATGCGTCACGTTGATTTTTCCCCGCTCTATCGCTCCACCGTCGGCTTCGACCGCCTGTTCACCATGTTGGACAGCCTGGGTCAGCCGGAT
CAGGCCCAGAGCTATCCGCCCTATAATATCGAGCGGACGGGCGACAATACCTACCGGATCACCATGGCCGTTGCCGGCTTCGATGAAACC
GAACTCAGCATCGAGGCCCATGCGCATGTGCTGGCGGTCAAGGGTGAGAAAGCCCAGGAAGACCAGGCCGAACAGACCGAGTTTCTGTAT
CGCGGCATTGCCAAGCGCGGGTTCGAGCGTCGTTTCCAGCTTGCCGACCATGTCGAGGTGACCAATGCCTCGCTGAAGAACGGCCTGCTG
CATATCGATCTGCTGCGCAATATTCCCGAAGCCATGAAGCCGCGCCGCATCGCCATTGCCAGCGAACCGGTCGAGGCGCCCAAGGCGATT
GAGTCTCGCGTCGTCTGA

Gene Information
Molecule Type genomic DNA
Bases 468 Bases
Molecular Weight144262.96 Da
Coding Sequence complement(CP000633.1:3103857..3104324)
NCBI ReferenceACM37688
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 40 to 140 100 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_AGVI1

Accession Number

sHsp_0022

Added on

2012-02-02

Updated On

2014-01-20