Help  Custom Search
 
Small heat shock protein of Agrobacterium tumefaciens str. C58

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Small heat shock protein

Synonymous Names

A9CFS9_AGRT5, HSP20

Taxon Information

Organism

Agrobacterium tumefaciens str. C58

Organism ID

176299 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium tumefaciens str. C58

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MRHVDFSPLYRSTVGFDRLFSMLDGLGQPEQAQSYPPYNIERTGENAYRITMAVAGFDETELSIESRANA LTVKAEKATDEKTTEGEFLYRGIATRAFERRFQLADHVEVQTASLKNGLLHIDLVRNIPEAMKPRRIAIS SDSAEAPKTIEAQITPAQVN

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCGTCACGTTGATTTTTCCCCCCTCTATCGTTCCACCGTCGGCTTCGACCGTCTTTTCTCGATGCTCGACGGCCTCGGCCAGCCTGA
ACAGGCCCAGTCCTATCCGCCCTATAATATCGAACGAACAGGTGAAAACGCCTATCGGATCACCATGGCGGTTGCCGGTTTCGATGAAAC
CGAACTCAGCATCGAATCCCGCGCCAACGCACTGACGGTGAAGGCCGAGAAGGCCACGGACGAAAAAACGACCGAAGGCGAATTCCTGTA
TCGCGGCATCGCGACGCGCGCTTTCGAGCGCCGCTTCCAGCTTGCCGATCACGTCGAAGTCCAGACCGCTTCCTTGAAGAACGGCCTGCT
TCACATCGACCTCGTCCGCAATATTCCGGAAGCCATGAAACCGCGCCGCATCGCGATCTCGTCCGACAGCGCCGAGGCGCCGAAGACGAT
CGAAGCCCAGATTACCCCGGCTCAGGTCAACTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine10923 %
Guanine12025 %
Thyamine9019 %
Cytosine16434 %
A+T19942 %
G+C28459 %

Total Bases :   483 bases

Microsatellites
SequencePosition LengthRepeats
CCCCCC1923
AAAAAA24123
CGCGCG28323

Microsatellite Map

ATGCGTCACGTTGATTTTTCCCCCCTCTATCGTTCCACCGTCGGCTTCGACCGTCTTTTCTCGATGCTCGACGGCCTCGGCCAGCCTGAA
CAGGCCCAGTCCTATCCGCCCTATAATATCGAACGAACAGGTGAAAACGCCTATCGGATCACCATGGCGGTTGCCGGTTTCGATGAAACC
GAACTCAGCATCGAATCCCGCGCCAACGCACTGACGGTGAAGGCCGAGAAGGCCACGGACGAAAAAACGACCGAAGGCGAATTCCTGTAT
CGCGGCATCGCGACGCGCGCTTTCGAGCGCCGCTTCCAGCTTGCCGATCACGTCGAAGTCCAGACCGCTTCCTTGAAGAACGGCCTGCTT
CACATCGACCTCGTCCGCAATATTCCGGAAGCCATGAAACCGCGCCGCATCGCGATCTCGTCCGACAGCGCCGAGGCGCCGAAGACGATC
GAAGCCCAGATTACCCCGGCTCAGGTCAACTAA

Gene Information
Molecule Type genomic DNA
Bases 483 Bases
Molecular Weight148386.65 Da
Coding Sequence AE007870.2:981981..982463
NCBI ReferenceAAK89532
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 41 to 138 97 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_AGTU4

Accession Number

sHsp_0021

Added on

2012-02-02

Updated On

2014-01-20