Help  Custom Search
 
Small heat shock protein of Agrobacterium tumefaciens str. C58

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Small heat shock protein

Synonymous Names

Q7D412_AGRT5, HSP20

Taxon Information

Organism

Agrobacterium tumefaciens str. C58

Organism ID

176299 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium tumefaciens str. C58

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MATSYDYAPLFRSSVGFDRVFNLLENAQRARSISDWPPYDIVKTGDDRYRIAIAVAGFEQGDLDITFQSN LLTVTGKEQETASEGYLHRGIAGRPFEHRFELADHVRVNGADLKNGLLSIDLVREIPEALKPQKIDIQTN PALAQPVAPAQIEAQKAA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAACATCTTACGACTATGCACCTCTGTTCCGTTCGAGCGTCGGGTTCGATCGGGTCTTCAATCTTCTCGAAAACGCCCAGCGCGC
CCGCTCGATCAGCGACTGGCCGCCCTATGACATCGTCAAGACCGGCGATGACAGATATCGCATCGCGATCGCGGTAGCGGGTTTCGAGCA
GGGCGATCTCGATATCACCTTCCAGTCCAACCTGCTGACCGTAACCGGCAAGGAGCAGGAGACGGCCTCTGAAGGTTATCTGCATCGCGG
CATTGCCGGCCGCCCGTTCGAACACCGGTTCGAGCTTGCCGATCATGTCAGGGTGAATGGCGCCGATCTGAAGAACGGTCTCCTGTCGAT
CGATCTCGTTCGCGAGATTCCCGAGGCCTTGAAACCGCAGAAGATCGACATCCAGACCAACCCGGCCCTCGCGCAACCGGTCGCCCCTGC
GCAGATCGAAGCGCAGAAGGCCGCTTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine10021 %
Guanine13228 %
Thyamine9220 %
Cytosine15333 %
A+T19241 %
G+C28560 %

Total Bases :   477 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC8323

Microsatellite Map

ATGGCAACATCTTACGACTATGCACCTCTGTTCCGTTCGAGCGTCGGGTTCGATCGGGTCTTCAATCTTCTCGAAAACGCCCAGCGCGCC
CGCTCGATCAGCGACTGGCCGCCCTATGACATCGTCAAGACCGGCGATGACAGATATCGCATCGCGATCGCGGTAGCGGGTTTCGAGCAG
GGCGATCTCGATATCACCTTCCAGTCCAACCTGCTGACCGTAACCGGCAAGGAGCAGGAGACGGCCTCTGAAGGTTATCTGCATCGCGGC
ATTGCCGGCCGCCCGTTCGAACACCGGTTCGAGCTTGCCGATCATGTCAGGGTGAATGGCGCCGATCTGAAGAACGGTCTCCTGTCGATC
GATCTCGTTCGCGAGATTCCCGAGGCCTTGAAACCGCAGAAGATCGACATCCAGACCAACCCGGCCCTCGCGCAACCGGTCGCCCCTGCG
CAGATCGAAGCGCAGAAGGCCGCTTAA

Gene Information
Molecule Type genomic DNA
Bases 477 Bases
Molecular Weight146945.7 Da
Coding Sequence AE007872.2:51311..51787
NCBI ReferenceAAK90427
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 41 to 138 97 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_AGTU2

Accession Number

sHsp_0019

Added on

2012-02-02

Updated On

2014-01-20