Help  Custom Search
 
small heat shock protein of Agrobacterium tumefaciens str. C58

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

small heat shock protein

Synonymous Names

A9CKC3_AGRT5, HSP20

Taxon Information

Organism

Agrobacterium tumefaciens str. C58

Organism ID

176299 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium tumefaciens str. C58

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MSRMTPFTHPLLLGFDAMEKTLERMAKANDGYPPYNIERLPGGEDVPERLRITIAVAGFSQDDLDVTTAD NQLVIRGRQQEQEKRDFLYRGIAARQFQRVFVLADGMQVREARLRNGLLSIDLVRPEISNVVKKINISVS E

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGCCGCATGACGCCATTCACCCACCCTCTTTTGCTGGGTTTTGATGCCATGGAAAAAACGCTGGAGCGTATGGCGAAGGCCAATGA
CGGCTACCCTCCCTATAATATCGAGCGTCTGCCTGGCGGAGAGGATGTGCCGGAGCGTCTGCGCATCACCATTGCCGTTGCCGGTTTTTC
GCAGGACGATCTGGATGTGACGACCGCCGACAACCAGCTTGTCATTCGCGGCCGCCAGCAGGAACAGGAAAAACGCGATTTTCTCTATCG
CGGCATTGCAGCGCGGCAGTTCCAGCGGGTCTTCGTGCTTGCCGATGGTATGCAGGTTCGCGAGGCGCGCTTGCGCAACGGCCTTCTTTC
CATCGATCTGGTCCGGCCGGAAATTTCAAACGTGGTAAAGAAAATTAATATTTCCGTCTCAGAGTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine8921 %
Guanine12129 %
Thyamine9924 %
Cytosine11728 %
A+T18845 %
G+C23856 %

Total Bases :   426 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA5523
GCGCGC33323

Microsatellite Map

ATGAGCCGCATGACGCCATTCACCCACCCTCTTTTGCTGGGTTTTGATGCCATGGAAAAAACGCTGGAGCGTATGGCGAAGGCCAATGAC
GGCTACCCTCCCTATAATATCGAGCGTCTGCCTGGCGGAGAGGATGTGCCGGAGCGTCTGCGCATCACCATTGCCGTTGCCGGTTTTTCG
CAGGACGATCTGGATGTGACGACCGCCGACAACCAGCTTGTCATTCGCGGCCGCCAGCAGGAACAGGAAAAACGCGATTTTCTCTATCGC
GGCATTGCAGCGCGGCAGTTCCAGCGGGTCTTCGTGCTTGCCGATGGTATGCAGGTTCGCGAGGCGCGCTTGCGCAACGGCCTTCTTTCC
ATCGATCTGGTCCGGCCGGAAATTTCAAACGTGGTAAAGAAAATTAATATTTCCGTCTCAGAGTAG

Gene Information
Molecule Type genomic DNA
Bases 426 Bases
Molecular Weight131598 Da
Coding Sequence AE007869.2:370520..370945
NCBI ReferenceAAK86192
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 44 to 140 96 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_AGTU1

Accession Number

sHsp_0018

Added on

2012-02-02

Updated On

2014-01-20