Help  Custom Search
 
molecular chaperone small heat shock protein of Agrobacterium radiobacter str. K84

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

molecular chaperone small heat shock protein

Synonymous Names

B9JA82_AGRRK, HSP20

Taxon Information

Organism

Agrobacterium radiobacter str. K84

Organism ID

311403 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium radiobacter K84

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MRHVDFTPLYRSTVGFDRLFTMLDSLAQPDQGQTYPPYNIERTGENTYRITMAVAGFDEKELSIEAHAHV LQVKGEKSEEPAEASEYLYRGIAKRAFERRFQLADHVEVQAASLKNGLLHIDLLRNIPEAMKPRRISIAA EPVDTPKAIEAHIG

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCGTCACGTAGACTTTACTCCCCTTTACCGTTCCACCGTCGGTTTCGACCGTCTCTTCACCATGCTCGACAGCCTTGCGCAACCGGA
TCAGGGTCAGACCTATCCGCCCTACAATATCGAGCGCACCGGCGAGAACACCTATCGCATTACCATGGCTGTTGCCGGGTTTGACGAAAA
GGAACTGAGCATCGAGGCTCACGCCCATGTTCTGCAGGTCAAGGGTGAAAAGAGCGAAGAGCCGGCGGAAGCCAGCGAATATCTCTATCG
CGGCATCGCCAAGCGCGCCTTCGAGCGTCGCTTCCAGCTCGCCGATCATGTCGAGGTCCAGGCGGCTTCGCTGAAGAATGGTCTGCTGCA
CATCGATCTGTTGCGCAACATTCCGGAAGCCATGAAGCCCCGCCGCATCTCCATCGCCGCCGAGCCGGTCGATACTCCGAAGGCGATCGA
AGCTCATATCGGCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine10122 %
Guanine12227 %
Thyamine9320 %
Cytosine14933 %
A+T19442 %
G+C27159 %

Total Bases :   465 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC28123

Microsatellite Map

ATGCGTCACGTAGACTTTACTCCCCTTTACCGTTCCACCGTCGGTTTCGACCGTCTCTTCACCATGCTCGACAGCCTTGCGCAACCGGAT
CAGGGTCAGACCTATCCGCCCTACAATATCGAGCGCACCGGCGAGAACACCTATCGCATTACCATGGCTGTTGCCGGGTTTGACGAAAAG
GAACTGAGCATCGAGGCTCACGCCCATGTTCTGCAGGTCAAGGGTGAAAAGAGCGAAGAGCCGGCGGAAGCCAGCGAATATCTCTATCGC
GGCATCGCCAAGCGCGCCTTCGAGCGTCGCTTCCAGCTCGCCGATCATGTCGAGGTCCAGGCGGCTTCGCTGAAGAATGGTCTGCTGCAC
ATCGATCTGTTGCGCAACATTCCGGAAGCCATGAAGCCCCGCCGCATCTCCATCGCCGCCGAGCCGGTCGATACTCCGAAGGCGATCGAA
GCTCATATCGGCTAA

Gene Information
Molecule Type genomic DNA
Bases 465 Bases
Molecular Weight143114.29 Da
Coding Sequence complement(CP000628.1:3059324..3059788)
NCBI ReferenceACM27697
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 40 to 139 99 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_AGRA1

Accession Number

sHsp_0017

Added on

2012-02-02

Updated On

2014-01-20