Help  Custom Search
 
heat shock protein, Hsp20 of Acidothermus cellulolyticus str. 11B

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein, Hsp20

Synonymous Names

A0LUY6_ACIC1, HSP20

Taxon Information

Organism

Acidothermus cellulolyticus str. 11B

Organism ID

351607 [NCBI] [UNIPROT]

Lineage

Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae; Acidothermaceae; Acidothermus; Acidothermus cellulolyticus 11B

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MALPVRATRNRAPARLDLFREFDELTDRLNQLWENTFGSLASDPWWSPLADIEETDDAYTVEIDLPGVKR DDVTVEFHNGELRVSGEIKERERTGILRRQTRRTGHFQYAVHLPGEIDVDKVTAQLTDGVLTVRLPKVAA AKGRRIEITSG

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCGCTTCCGGTCCGGGCGACAAGGAATCGTGCACCGGCTCGGCTCGACCTGTTCCGGGAGTTCGACGAACTGACGGACCGACTGAA
CCAATTGTGGGAGAACACGTTCGGCAGTTTGGCGAGTGATCCATGGTGGTCGCCGCTTGCCGATATCGAAGAAACGGACGACGCGTACAC
GGTGGAAATCGATCTCCCGGGCGTCAAACGGGATGACGTCACGGTGGAATTTCACAACGGCGAACTGCGGGTCAGCGGGGAAATCAAAGA
GCGGGAGCGAACCGGTATTTTACGGCGGCAAACACGTCGGACAGGACACTTCCAGTATGCCGTCCACCTCCCTGGTGAGATCGATGTCGA
CAAGGTGACCGCCCAGCTGACCGACGGTGTCCTTACCGTGCGTCTCCCCAAGGTGGCCGCGGCTAAAGGCCGCCGCATCGAGATCACCTC
CGGATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine10223 %
Guanine14532 %
Thyamine7918 %
Cytosine13029 %
A+T18140 %
G+C27561 %

Total Bases :   456 bases

Microsatellites
SequencePosition LengthRepeats

Microsatellite Map

ATGGCGCTTCCGGTCCGGGCGACAAGGAATCGTGCACCGGCTCGGCTCGACCTGTTCCGGGAGTTCGACGAACTGACGGACCGACTGAAC
CAATTGTGGGAGAACACGTTCGGCAGTTTGGCGAGTGATCCATGGTGGTCGCCGCTTGCCGATATCGAAGAAACGGACGACGCGTACACG
GTGGAAATCGATCTCCCGGGCGTCAAACGGGATGACGTCACGGTGGAATTTCACAACGGCGAACTGCGGGTCAGCGGGGAAATCAAAGAG
CGGGAGCGAACCGGTATTTTACGGCGGCAAACACGTCGGACAGGACACTTCCAGTATGCCGTCCACCTCCCTGGTGAGATCGATGTCGAC
AAGGTGACCGCCCAGCTGACCGACGGTGTCCTTACCGTGCGTCTCCCCAAGGTGGCCGCGGCTAAAGGCCGCCGCATCGAGATCACCTCC
GGATAA

Gene Information
Molecule Type genomic DNA
Bases 456 Bases
Molecular Weight141246.11 Da
Coding Sequence CP000481.1:1653858..1654313
NCBI ReferenceABK53246
NotesPFAM: heat shock protein Hsp20; CS; KEGG:

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 51 to 149 98 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_ACCE3

Accession Number

sHsp_0016

Added on

2012-02-02

Updated On

2014-01-20