Help  Custom Search
 
heat shock protein, Hsp20 family of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein, Hsp20 family

Synonymous Names

C1F1A2_ACIC5, HSP20

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MAITRWDPFRDVLALQNRMNSLFQDYARTGGDDLVSTASFVPPVDIYEDEHRIVLKLEVPGMKQEDFDIQ LENNTLTIRGERKFEKEEKEENFHRIERRYGTFFRSFAVPNTVNTEQVKAGYDAGVLRIELAKREETKPK QIKVQVGAGPVKTVENKPAA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAATCACTCGTTGGGACCCGTTTCGGGATGTGCTCGCTCTGCAGAACCGCATGAACTCGCTCTTCCAGGACTATGCCCGCACGGG
CGGGGATGATCTGGTTTCGACGGCGTCGTTCGTTCCGCCGGTCGATATCTATGAAGACGAGCACAGGATTGTGCTGAAGCTCGAAGTGCC
GGGCATGAAGCAGGAGGACTTCGACATTCAACTGGAAAACAACACGCTGACGATTCGCGGCGAGCGGAAGTTTGAGAAAGAAGAGAAGGA
AGAGAACTTCCATCGCATTGAGCGGCGTTATGGTACGTTCTTCCGGTCGTTTGCGGTGCCGAACACCGTTAACACCGAGCAGGTGAAGGC
GGGCTATGATGCGGGCGTGTTGCGGATTGAGCTGGCGAAGCGCGAGGAGACCAAGCCGAAGCAGATCAAGGTGCAGGTGGGCGCAGGTCC
AGTGAAGACGGTGGAGAACAAGCCGGCGGCGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine11424 %
Guanine16535 %
Thyamine9119 %
Cytosine11324 %
A+T20543 %
G+C27858 %

Total Bases :   483 bases

Microsatellites
SequencePosition LengthRepeats

Microsatellite Map

ATGGCAATCACTCGTTGGGACCCGTTTCGGGATGTGCTCGCTCTGCAGAACCGCATGAACTCGCTCTTCCAGGACTATGCCCGCACGGGC
GGGGATGATCTGGTTTCGACGGCGTCGTTCGTTCCGCCGGTCGATATCTATGAAGACGAGCACAGGATTGTGCTGAAGCTCGAAGTGCCG
GGCATGAAGCAGGAGGACTTCGACATTCAACTGGAAAACAACACGCTGACGATTCGCGGCGAGCGGAAGTTTGAGAAAGAAGAGAAGGAA
GAGAACTTCCATCGCATTGAGCGGCGTTATGGTACGTTCTTCCGGTCGTTTGCGGTGCCGAACACCGTTAACACCGAGCAGGTGAAGGCG
GGCTATGATGCGGGCGTGTTGCGGATTGAGCTGGCGAAGCGCGAGGAGACCAAGCCGAAGCAGATCAAGGTGCAGGTGGGCGCAGGTCCA
GTGAAGACGGTGGAGAACAAGCCGGCGGCGTAA

Gene Information
Molecule Type genomic DNA
Bases 483 Bases
Molecular Weight150323.17 Da
Coding Sequence CP001472.1:2780167..2780649
NCBI ReferenceACO34416
Notesidentified by match to protein family HMM PF00011

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 45 to 147 102 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_ACCA1

Accession Number

sHsp_0012

Added on

2012-02-02

Updated On

2014-01-20