Help  Custom Search
 
heat shock protein Hsp20 of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein Hsp20

Synonymous Names

B5EPP8_ACIF5, HSP20

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MRDLEDIMWMQAIDMLERAERLQRRFFQPAPSGRQPAWQPPMDVFESSGGLQIVVALPGVSPEEVQVIFS GNVLIVSGQRRLSAELQTGHIHRLEIPYGVFDRRLQIPDGLTLQGWEMRDGCLHLSFRRQRGMK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCGCGATCTGGAAGACATTATGTGGATGCAAGCCATAGACATGTTGGAGCGTGCGGAACGCTTGCAGCGGCGCTTCTTTCAGCCGGC
CCCGTCGGGTCGCCAGCCAGCCTGGCAGCCGCCCATGGATGTCTTTGAGAGCAGTGGTGGGCTGCAGATTGTCGTGGCATTGCCCGGCGT
TAGCCCGGAGGAGGTACAGGTAATCTTCAGCGGCAACGTCCTGATAGTGAGTGGTCAACGTCGGCTTTCCGCAGAACTGCAAACGGGGCA
TATCCATCGTCTGGAGATCCCCTACGGCGTTTTCGACCGGCGCCTGCAGATTCCCGATGGCTTGACGTTGCAGGGCTGGGAAATGCGCGA
TGGCTGTCTCCATTTGTCCTTTCGCCGGCAAAGGGGTATGAAATGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine7619 %
Guanine13233 %
Thyamine9123 %
Cytosine10627 %
A+T16742 %
G+C23859 %

Total Bases :   405 bases

Microsatellites
SequencePosition LengthRepeats

Microsatellite Map

ATGCGCGATCTGGAAGACATTATGTGGATGCAAGCCATAGACATGTTGGAGCGTGCGGAACGCTTGCAGCGGCGCTTCTTTCAGCCGGCC
CCGTCGGGTCGCCAGCCAGCCTGGCAGCCGCCCATGGATGTCTTTGAGAGCAGTGGTGGGCTGCAGATTGTCGTGGCATTGCCCGGCGTT
AGCCCGGAGGAGGTACAGGTAATCTTCAGCGGCAACGTCCTGATAGTGAGTGGTCAACGTCGGCTTTCCGCAGAACTGCAAACGGGGCAT
ATCCATCGTCTGGAGATCCCCTACGGCGTTTTCGACCGGCGCCTGCAGATTCCCGATGGCTTGACGTTGCAGGGCTGGGAAATGCGCGAT
GGCTGTCTCCATTTGTCCTTTCGCCGGCAAAGGGGTATGAAATGA

Gene Information
Molecule Type genomic DNA
Bases 405 Bases
Molecular Weight125533 Da
Coding Sequence CP001132.1:967261..967665
NCBI ReferenceACH83242
NotesPFAM: heat shock protein Hsp20; KEGG: rfr:Rfer_3005

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 43 to 134 91 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_ACFE3

Accession Number

sHsp_0011

Added on

2012-02-02

Updated On

2014-01-20