Help  Custom Search
 
heat shock protein Hsp20 of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein Hsp20

Synonymous Names

B5ERR0_ACIF5, HSP20

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MANEVSRPVVKSVRQVEPLENLIETVWPGVFSPFITRQATQPQIAHIDVLDHDDAFVLKAEIAGVDKDKL DVQVHGNQVYISGVKEEDSSREEGNYIYRERRYGEFSRTVQLPADVNGDQTKAIYKDGVLELTLPKTESA KRKKIAIS

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAAATGAAGTTTCACGTCCGGTGGTCAAGAGTGTTCGTCAGGTAGAACCTTTGGAAAACTTAATAGAAACAGTGTGGCCTGGAGT
ATTTTCTCCTTTCATTACCCGACAGGCCACGCAACCCCAAATCGCGCATATTGATGTCCTTGATCACGATGACGCTTTTGTATTGAAGGC
GGAGATTGCCGGCGTAGATAAGGATAAGCTGGATGTCCAGGTACACGGTAACCAGGTCTATATCAGTGGCGTCAAGGAAGAAGATAGCTC
TCGGGAAGAAGGGAATTATATCTACCGAGAGCGTCGATATGGAGAGTTTTCTCGCACCGTGCAGCTCCCTGCAGATGTGAATGGCGATCA
AACCAAGGCCATATACAAAGATGGTGTTTTAGAGTTGACTCTGCCTAAAACAGAATCTGCCAAACGCAAAAAGATTGCGATTTCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine12929 %
Guanine11526 %
Thyamine11025 %
Cytosine9321 %
A+T23954 %
G+C20847 %

Total Bases :   447 bases

Microsatellites
SequencePosition LengthRepeats

Microsatellite Map

ATGGCAAATGAAGTTTCACGTCCGGTGGTCAAGAGTGTTCGTCAGGTAGAACCTTTGGAAAACTTAATAGAAACAGTGTGGCCTGGAGTA
TTTTCTCCTTTCATTACCCGACAGGCCACGCAACCCCAAATCGCGCATATTGATGTCCTTGATCACGATGACGCTTTTGTATTGAAGGCG
GAGATTGCCGGCGTAGATAAGGATAAGCTGGATGTCCAGGTACACGGTAACCAGGTCTATATCAGTGGCGTCAAGGAAGAAGATAGCTCT
CGGGAAGAAGGGAATTATATCTACCGAGAGCGTCGATATGGAGAGTTTTCTCGCACCGTGCAGCTCCCTGCAGATGTGAATGGCGATCAA
ACCAAGGCCATATACAAAGATGGTGTTTTAGAGTTGACTCTGCCTAAAACAGAATCTGCCAAACGCAAAAAGATTGCGATTTCCTGA

Gene Information
Molecule Type genomic DNA
Bases 447 Bases
Molecular Weight138557.02 Da
Coding Sequence complement(CP001132.1:1300488..1300934)
NCBI ReferenceACH83581
NotesPFAM: heat shock protein Hsp20; KEGG: noc:Noc_1573

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 48 to 148 100 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_ACFE2

Accession Number

sHsp_0010

Added on

2012-02-02

Updated On

2014-01-20