Help  Custom Search
 
heat shock protein Hsp20 of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein Hsp20

Synonymous Names

A5G1U1_ACICJ, HSP20

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MTLDFSPLFRTAIGFDRLQQLLDSVPDGNATAYPPYNIEKLGPEDYRLTMAVAGFRAEDLDMTVKDNTLI ITGRIAEGASKGEVLYRGIASRAFERRFVLADHMVVDGAALENGLLHVALKRVIPEALKPRKIAIGTGAP AATPVIEQDKAAA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGACGCTCGATTTTTCCCCGCTTTTCCGCACCGCCATCGGCTTCGACCGGCTGCAGCAGCTGCTTGACAGCGTGCCGGACGGCAACGC
CACCGCCTATCCCCCCTACAATATCGAGAAACTCGGCCCCGAGGACTACCGCCTGACCATGGCGGTGGCCGGATTCCGCGCCGAGGACCT
GGACATGACGGTGAAGGACAACACGCTCATCATCACCGGACGGATCGCCGAGGGGGCGAGCAAGGGCGAGGTGCTCTATCGCGGCATCGC
CTCGCGCGCGTTCGAACGGCGCTTCGTGCTGGCCGACCACATGGTGGTCGATGGCGCGGCGCTGGAGAACGGGCTGCTGCACGTGGCGCT
GAAGCGCGTGATTCCCGAGGCGCTGAAGCCGCGGAAGATCGCCATCGGCACCGGCGCGCCGGCGGCCACGCCCGTGATCGAACAGGACAA
GGCGGCCGCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine8218 %
Guanine15434 %
Thyamine6815 %
Cytosine15835 %
A+T15033 %
G+C31268 %

Total Bases :   462 bases

Microsatellites
SequencePosition LengthRepeats
CCCCCC9923
TCATCATCA20533
CGCGCGCG27124
GCGCGC41223

Microsatellite Map

ATGACGCTCGATTTTTCCCCGCTTTTCCGCACCGCCATCGGCTTCGACCGGCTGCAGCAGCTGCTTGACAGCGTGCCGGACGGCAACGCC
ACCGCCTATCCCCCCTACAATATCGAGAAACTCGGCCCCGAGGACTACCGCCTGACCATGGCGGTGGCCGGATTCCGCGCCGAGGACCTG
GACATGACGGTGAAGGACAACACGCTCATCATCACCGGACGGATCGCCGAGGGGGCGAGCAAGGGCGAGGTGCTCTATCGCGGCATCGCC
TCGCGCGCGTTCGAACGGCGCTTCGTGCTGGCCGACCACATGGTGGTCGATGGCGCGGCGCTGGAGAACGGGCTGCTGCACGTGGCGCTG
AAGCGCGTGATTCCCGAGGCGCTGAAGCCGCGGAAGATCGCCATCGGCACCGGCGCGCCGGCGGCCACGCCCGTGATCGAACAGGACAAG
GCGGCCGCCTGA

Gene Information
Molecule Type genomic DNA
Bases 462 Bases
Molecular Weight142695.64 Da
Coding Sequence complement(CP000697.1:2887319..2887780)
NCBI ReferenceABQ31823
NotesPFAM: heat shock protein Hsp20

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 38 to 136 98 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_ACCR3

Accession Number

sHsp_0008

Added on

2012-02-02

Updated On

2014-01-20