Help  Custom Search
 
Heat shock protein (HSP20) family protein of Acholeplasma laidlawii str. PG-8A

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein (HSP20) family protein

Synonymous Names

A9NFB2_ACHLI, HSP20

Taxon Information

Organism

Acholeplasma laidlawii str. PG-8A

Organism ID

441768 [NCBI] [UNIPROT]

Lineage

Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Acholeplasma; Acholeplasma laidlawii PG-8A

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MLSLLNKNRSFFDDFFEDFNVLNPVTTSNLMRTDIKETQNGYSLSVELPGFKKEDVKVSLEDGYLTIEAH TSKNSETKDQATKYIRKERYEGTMKRSYYVGNLHLDEINGTFENGMLHIELPKETKKEPEKRYLELK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTTGAGTTTATTGAACAAGAATAGAAGTTTCTTTGATGATTTCTTCGAAGACTTCAATGTGCTTAATCCGGTGACTACTTCTAACTT
AATGAGAACAGATATTAAAGAAACACAAAATGGTTACTCATTATCCGTAGAACTTCCTGGATTTAAAAAAGAGGATGTAAAGGTAAGCTT
AGAGGATGGTTACTTAACTATAGAAGCTCATACTTCTAAGAATTCAGAAACCAAAGATCAAGCTACTAAATACATCAGAAAAGAAAGATA
TGAAGGTACTATGAAACGTAGTTATTATGTAGGTAACCTACATCTTGATGAAATCAATGGTACTTTTGAAAACGGTATGTTACATATCGA
ACTTCCAAAAGAAACCAAAAAAGAGCCTGAAAAACGTTATTTAGAACTTAAATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine16641 %
Guanine7118 %
Thyamine11929 %
Cytosine5815 %
A+T28569 %
G+C12932 %

Total Bases :   414 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA15323
AAAAAA37523

Microsatellite Map

ATGTTGAGTTTATTGAACAAGAATAGAAGTTTCTTTGATGATTTCTTCGAAGACTTCAATGTGCTTAATCCGGTGACTACTTCTAACTTA
ATGAGAACAGATATTAAAGAAACACAAAATGGTTACTCATTATCCGTAGAACTTCCTGGATTTAAAAAAGAGGATGTAAAGGTAAGCTTA
GAGGATGGTTACTTAACTATAGAAGCTCATACTTCTAAGAATTCAGAAACCAAAGATCAAGCTACTAAATACATCAGAAAAGAAAGATAT
GAAGGTACTATGAAACGTAGTTATTATGTAGGTAACCTACATCTTGATGAAATCAATGGTACTTTTGAAAACGGTATGTTACATATCGAA
CTTCCAAAAGAAACCAAAAAAGAGCCTGAAAAACGTTATTTAGAACTTAAATAA

Gene Information
Molecule Type genomic DNA
Bases 414 Bases
Molecular Weight128277.05 Da
Coding Sequence complement(CP000896.1:441919..442332)
NCBI ReferenceABX81042
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 34 to 137 103 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_ACLA1

Accession Number

sHsp_0005

Added on

2012-02-02

Updated On

2014-01-20