Help  Custom Search
 
Heat shock protein (HSP20) family protein of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein (HSP20) family protein

Synonymous Names

B0C7V1_ACAM1, HSP20

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to sHsp Protein family

SEQUENCE INFORMATION

Sequence
MIRYWNPIEEADAIRHQLDRLFDGMLDTDTSTVNWSPAIEVWDQGNALVLKAFLPGVKADDLDIQVTRKS VSLSGQRHAEDLPEDAKRLYSDIRYGQFQRATKLPVEVQNTKVDASFEQGLLTLTLPKVEAEQHKVVKVN LTGESPAIDAADDA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGATTCGTTACTGGAATCCGATTGAAGAAGCAGATGCGATCCGTCATCAACTCGATCGCCTCTTTGACGGTATGTTGGATACGGACAC
GTCCACCGTCAATTGGTCCCCTGCAATTGAAGTCTGGGACCAAGGCAATGCCCTGGTCCTCAAAGCCTTCTTGCCAGGGGTTAAGGCGGA
CGATTTGGATATTCAGGTGACTCGAAAGTCCGTTTCCCTGTCAGGTCAGCGCCATGCCGAGGACCTACCAGAAGATGCCAAGCGCCTCTA
CTCTGACATCCGTTATGGACAGTTCCAACGGGCCACCAAGCTGCCGGTGGAAGTGCAAAACACCAAAGTAGATGCATCCTTTGAGCAAGG
TTTGCTCACCCTCACCCTGCCCAAGGTTGAAGCCGAACAACACAAAGTGGTGAAGGTTAACTTGACTGGCGAGTCACCTGCGATTGATGC
AGCTGACGATGCCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine11726 %
Guanine11926 %
Thyamine10423 %
Cytosine12527 %
A+T22148 %
G+C24453 %

Total Bases :   465 bases

Microsatellites
SequencePosition LengthRepeats

Microsatellite Map

ATGATTCGTTACTGGAATCCGATTGAAGAAGCAGATGCGATCCGTCATCAACTCGATCGCCTCTTTGACGGTATGTTGGATACGGACACG
TCCACCGTCAATTGGTCCCCTGCAATTGAAGTCTGGGACCAAGGCAATGCCCTGGTCCTCAAAGCCTTCTTGCCAGGGGTTAAGGCGGAC
GATTTGGATATTCAGGTGACTCGAAAGTCCGTTTCCCTGTCAGGTCAGCGCCATGCCGAGGACCTACCAGAAGATGCCAAGCGCCTCTAC
TCTGACATCCGTTATGGACAGTTCCAACGGGCCACCAAGCTGCCGGTGGAAGTGCAAAACACCAAAGTAGATGCATCCTTTGAGCAAGGT
TTGCTCACCCTCACCCTGCCCAAGGTTGAAGCCGAACAACACAAAGTGGTGAAGGTTAACTTGACTGGCGAGTCACCTGCGATTGATGCA
GCTGACGATGCCTAA

Gene Information
Molecule Type genomic DNA
Bases 465 Bases
Molecular Weight143543.9 Da
Coding Sequence complement(CP000828.1:1454103..1454567)
NCBI ReferenceABW26492
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
sHsp 40 to 142 103 Alpha-crystallin domain PF00011

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

sHsp_ACMA1

Accession Number

sHsp_0001

Added on

2012-02-02

Updated On

2014-01-20