Help  Custom Search
 
Endoplasmin precursor. of Canis lupus familiaris

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Endoplasmin precursor.

Synonymous Names

ENPL_CANFA, Heat shock protein Hsp90, 94 kDa glucose-regulated protein, Heat shock protein 90 kDa beta member 1, GRP94.

Taxon Information

Organism

Canis lupus familiaris

Organism ID

9615 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis; Canis lupus familiaris

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

HSP90B/Grp94
(ER Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELR EKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDK EKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVI VTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIY VWSSKTETVEEPMEEEEAAKEEKEDSDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEV EDDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYNDTFWKEFGT NIKLGVIEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLK KGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAIEKEFEPLLNWMKDKALKDK IEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIKDMLRR VKEDEDDKTVSDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETTEDT TEDTEQDDEEEMDAGTDDEEQETVKKSTAEKDEL

FASTA Format Composition Secondary Structure

Nucleotide
 CCGCGCGGCTTGTGGTCTGAGCGTCTGATCCCCGGGGTGGGGGGTGGAGGCGGCTCCTACTATCAAAAGGGACGTGAGACTCCCACCGG
CCGCGCGCCATGAGGGCCCTGTGGGTGCTGGGCCTCTGCTGCGTCCTGCTGACCTTCGGGTCAGTCCGAGCTGACGATGAAGTCGATGTG
GATGGTACAGTGGAAGAGGATCTGGGTAAAAGTAGAGAAGGCTCCAGGACAGATGATGAAGTAGTGCAGAGAGAGGAAGAAGCTATTCAG
TTGGATGGATTAAATGCATCCCAAATAAGAGAACTTAGAGAAAAATCAGAAAAATTTGCCTTCCAAGCTGAAGTGAATAGAATGATGAAA
CTTATCATCAATTCATTGTATAAAAATAAAGAGATTTTCTTGAGAGAACTGATTTCAAATGCTTCTGATGCCTTAGATAAGATAAGGTTA
ATATCACTGACTGATGAAAATGCTCTTGCTGGAAATGAGGAACTAACTGTCAAAATTAAGTGTGACAAGGAGAAGAATCTGCTACATGTC
ACAGACACTGGTGTGGGAATGACCCGGGAAGAGTTGGTTAAAAACCTTGGTACCATAGCCAAATCTGGAACAAGCGAGTTTTTAAACAAA
ATGACTGAGGCACAAGAGGATGGCCAGTCAACTTCTGAACTGATTGGGCAGTTTGGTGTCGGTTTCTATTCTGCCTTCCTTGTCGCAGAT
AAGGTTATTGTCACATCAAAACACAACAACGATACCCAGCATATCTGGGAATCTGACTCCAATGAGTTCTCTGTAATTGCTGACCCACGA
GGGAACACCCTCGGACGGGGAACAACAATTACACTTGTTTTAAAAGAAGAAGCATCTGATTACCTTGAATTGGACACAATTAAAAATCTC
GTCAAGAAATATTCACAGTTTATAAACTTCCCTATTTATGTGTGGAGCAGCAAGACTGAAACTGTTGAGGAGCCCATGGAAGAAGAAGAA
GCAGCAAAAGAAGAAAAAGAAGATTCTGATGATGAAGCTGCAGTGGAAGAAGAAGAGGAGGAAAAAAAACCAAAAACCAAAAAAGTTGAG
AAAACTGTCTGGGATTGGGAGCTTATGAATGACATCAAACCAATATGGCAGAGACCATCAAAAGAAGTAGAAGATGACGAATACAAAGCT
TTCTACAAATCATTTTCAAAGGAAAGTGATGACCCCATGGCTTATATCCACTTTACTGCTGAAGGGGAAGTCACCTTCAAATCAATTTTA
TTTGTACCTACATCTGCTCCACGTGGTCTGTTTGATGAATATGGATCTAAGAAGAGTGATTACATTAAGCTTTACGTGCGCAGAGTATTC
ATCACAGATGACTTCCATGATATGATGCCCAAGTACCTTAACTTTGTCAAGGGTGTTGTGGACTCAGATGATCTCCCCTTGAATGTTTCC
CGGGAAACTCTTCAGCAACATAAACTGCTTAAGGTGATTAGAAAGAAGCTTGTCCGTAAAACTCTGGACATGATCAAGAAGATTGCTGAT
GAGAAGTACAATGATACTTTTTGGAAAGAATTTGGTACCAACATCAAGCTTGGTGTAATTGAAGACCACTCAAATCGAACACGTCTTGCT
AAACTTCTTAGATTCCAGTCATCTCATCATCCAAGTGACATAACCAGTCTAGACCAATACGTGGAAAGAATGAAGGAGAAGCAAGACAAA
ATCTACTTCATGGCTGGGTCTAGCAGAAAAGAGGCTGAATCTTCTCCATTTGTTGAGCGACTTCTGAAAAAGGGCTATGAAGTGATTTAT
CTCACCGAACCTGTGGACGAATACTGCATTCAGGCTCTTCCTGAGTTTGATGGGAAAAGGTTCCAGAATGTTGCCAAAGAAGGTGTGAAA
TTTGATGAAAGTGAGAAAACAAAGGAGAGTCGTGAAGCGATTGAGAAAGAATTTGAGCCTCTGCTCAACTGGATGAAAGATAAAGCTCTC
AAGGACAAGATTGAAAAGGCCGTGGTATCTCAGCGTCTGACAGAGTCTCCGTGTGCTCTGGTGGCCAGCCAGTATGGATGGTCTGGCAAC
ATGGAGAGAATCATGAAAGCTCAAGCATACCAGACGGGCAAAGACATCTCTACAAATTACTATGCCAGCCAAAAGAAAACATTTGAAATT
AATCCCAGACATCCCCTGATCAAAGACATGCTGCGACGAGTTAAGGAAGATGAAGATGACAAAACGGTATCGGATCTTGCTGTGGTTTTG
TTTGAGACAGCAACGCTGAGATCAGGCTATCTGCTACCAGACACTAAAGCATATGGAGATCGAATAGAAAGAATGCTTCGCCTCAGTTTA
AACATTGACCCTGATGCAAAGGTGGAAGAAGAACCAGAAGAAGAACCCGAAGAGACAACCGAGGACACCACAGAAGACACAGAGCAGGAC
GATGAAGAAGAAATGGATGCAGGAACAGACGACGAAGAACAAGAAACAGTAAAGAAATCTACAGCTGAAAAAGATGAATTATAAATTATA
CTCTCACCATTTGGAACCTGTGTGGAGAGGGAATGTGAAATTTAAGTCATTTCTTTCGAGAGAGACTTGTTTTGGATGCTCCCCGCAGCC
CCCTTCTCCCCTGCACTGTAAAATGTTGGGATTGTGGGTCACAGAAAGAAGTGGGTTTTTTAGTTGAATTTTTTTTTTTAACATTCCTCA
TGAATGTAAATTTGTACTATTTAACTGACTATTCTTGGTGTAAAATCTTGTCATGTGTATAAAAATAAAAAAGATCCCAAAT 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine93134 %
Guanine65924 %
Thyamine68025 %
Cytosine51119 %
A+T161158 %
G+C117043 %

Total Bases :   2781 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG123
GGGGGG3823
CGCGCG9023
AGAGAGAG24624
GAGAGA40023
AAGAAGAAG85233
TGTGTG93723
GAAGAAGAAGAA97734
TGATGATGA101533
GAAGAAGAA103433
AAAAAAAA105024
AAAAAA106723
GAGAGA207223
GAAGAAGAA236333
AGAAGAAGA237433
GAAGAAGAA243233
TGTGTG253723
GAGAGAGA257624
TTTTTT266423
TTTTTTTTTT267725
AAAAAA276523

Microsatellite Map

CCGCGCGGCTTGTGGTCTGAGCGTCTGATCCCCGGGGTGGGGGGTGGAGGCGGCTCCTACTATCAAAAGGGACGTGAGACTCCCACCGGC
CGCGCGCCATGAGGGCCCTGTGGGTGCTGGGCCTCTGCTGCGTCCTGCTGACCTTCGGGTCAGTCCGAGCTGACGATGAAGTCGATGTGG
ATGGTACAGTGGAAGAGGATCTGGGTAAAAGTAGAGAAGGCTCCAGGACAGATGATGAAGTAGTGCAGAGAGAGGAAGAAGCTATTCAGT
TGGATGGATTAAATGCATCCCAAATAAGAGAACTTAGAGAAAAATCAGAAAAATTTGCCTTCCAAGCTGAAGTGAATAGAATGATGAAAC
TTATCATCAATTCATTGTATAAAAATAAAGAGATTTTCTTGAGAGAACTGATTTCAAATGCTTCTGATGCCTTAGATAAGATAAGGTTAA
TATCACTGACTGATGAAAATGCTCTTGCTGGAAATGAGGAACTAACTGTCAAAATTAAGTGTGACAAGGAGAAGAATCTGCTACATGTCA
CAGACACTGGTGTGGGAATGACCCGGGAAGAGTTGGTTAAAAACCTTGGTACCATAGCCAAATCTGGAACAAGCGAGTTTTTAAACAAAA
TGACTGAGGCACAAGAGGATGGCCAGTCAACTTCTGAACTGATTGGGCAGTTTGGTGTCGGTTTCTATTCTGCCTTCCTTGTCGCAGATA
AGGTTATTGTCACATCAAAACACAACAACGATACCCAGCATATCTGGGAATCTGACTCCAATGAGTTCTCTGTAATTGCTGACCCACGAG
GGAACACCCTCGGACGGGGAACAACAATTACACTTGTTTTAAAAGAAGAAGCATCTGATTACCTTGAATTGGACACAATTAAAAATCTCG
TCAAGAAATATTCACAGTTTATAAACTTCCCTATTTATGTGTGGAGCAGCAAGACTGAAACTGTTGAGGAGCCCATGGAAGAAGAAGAAG
CAGCAAAAGAAGAAAAAGAAGATTCTGATGATGAAGCTGCAGTGGAAGAAGAAGAGGAGGAAAAAAAACCAAAAACCAAAAAAGTTGAGA
AAACTGTCTGGGATTGGGAGCTTATGAATGACATCAAACCAATATGGCAGAGACCATCAAAAGAAGTAGAAGATGACGAATACAAAGCTT
TCTACAAATCATTTTCAAAGGAAAGTGATGACCCCATGGCTTATATCCACTTTACTGCTGAAGGGGAAGTCACCTTCAAATCAATTTTAT
TTGTACCTACATCTGCTCCACGTGGTCTGTTTGATGAATATGGATCTAAGAAGAGTGATTACATTAAGCTTTACGTGCGCAGAGTATTCA
TCACAGATGACTTCCATGATATGATGCCCAAGTACCTTAACTTTGTCAAGGGTGTTGTGGACTCAGATGATCTCCCCTTGAATGTTTCCC
GGGAAACTCTTCAGCAACATAAACTGCTTAAGGTGATTAGAAAGAAGCTTGTCCGTAAAACTCTGGACATGATCAAGAAGATTGCTGATG
AGAAGTACAATGATACTTTTTGGAAAGAATTTGGTACCAACATCAAGCTTGGTGTAATTGAAGACCACTCAAATCGAACACGTCTTGCTA
AACTTCTTAGATTCCAGTCATCTCATCATCCAAGTGACATAACCAGTCTAGACCAATACGTGGAAAGAATGAAGGAGAAGCAAGACAAAA
TCTACTTCATGGCTGGGTCTAGCAGAAAAGAGGCTGAATCTTCTCCATTTGTTGAGCGACTTCTGAAAAAGGGCTATGAAGTGATTTATC
TCACCGAACCTGTGGACGAATACTGCATTCAGGCTCTTCCTGAGTTTGATGGGAAAAGGTTCCAGAATGTTGCCAAAGAAGGTGTGAAAT
TTGATGAAAGTGAGAAAACAAAGGAGAGTCGTGAAGCGATTGAGAAAGAATTTGAGCCTCTGCTCAACTGGATGAAAGATAAAGCTCTCA
AGGACAAGATTGAAAAGGCCGTGGTATCTCAGCGTCTGACAGAGTCTCCGTGTGCTCTGGTGGCCAGCCAGTATGGATGGTCTGGCAACA
TGGAGAGAATCATGAAAGCTCAAGCATACCAGACGGGCAAAGACATCTCTACAAATTACTATGCCAGCCAAAAGAAAACATTTGAAATTA
ATCCCAGACATCCCCTGATCAAAGACATGCTGCGACGAGTTAAGGAAGATGAAGATGACAAAACGGTATCGGATCTTGCTGTGGTTTTGT
TTGAGACAGCAACGCTGAGATCAGGCTATCTGCTACCAGACACTAAAGCATATGGAGATCGAATAGAAAGAATGCTTCGCCTCAGTTTAA
ACATTGACCCTGATGCAAAGGTGGAAGAAGAACCAGAAGAAGAACCCGAAGAGACAACCGAGGACACCACAGAAGACACAGAGCAGGACG
ATGAAGAAGAAATGGATGCAGGAACAGACGACGAAGAACAAGAAACAGTAAAGAAATCTACAGCTGAAAAAGATGAATTATAAATTATAC
TCTCACCATTTGGAACCTGTGTGGAGAGGGAATGTGAAATTTAAGTCATTTCTTTCGAGAGAGACTTGTTTTGGATGCTCCCCGCAGCCC
CCTTCTCCCCTGCACTGTAAAATGTTGGGATTGTGGGTCACAGAAAGAAGTGGGTTTTTTAGTTGAATTTTTTTTTTTAACATTCCTCAT
GAATGTAAATTTGTACTATTTAACTGACTATTCTTGGTGTAAAATCTTGTCATGTGTATAAAAATAAAAAAGATCCCAAAT

Gene Information
Molecule Type mRNA
Bases 2781 Bases
Molecular Weight863112.92 Da
Coding Sequence 99..2513
NCBI ReferenceNM_001003327
Notes Canis lupus familiaris heat shock protein 90kDa beta (Grp94);member 1 (HSP90B1); mRNA. endoplasminprecursor

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
signal peptide 1 to 21 21 ER targeting peptide Manually identified
N-terminal Domain 72 to 373 302 ATPase domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 338 to 594 257 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 617 to 745 129 C-terminal Domain of HSP90 SSF110942
coiled coil 294 to 320 27 Coiled Coil Region Manually identified

Graphical View

STRUCTURE   hide


ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GRP94_CALU1

Accession Number

HSP90_0350

Added on

2012-02-02

Updated On

2014-01-20