Help  Custom Search
 
Cytosolic heat shock protein 90. of Hordeum vulgare

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Cytosolic heat shock protein 90.

Synonymous Names

Q7XJ80_HORVU, Heat shock protein Hsp90, HSP90.

Taxon Information

Organism

Hordeum vulgare

Organism ID

4513 [NCBI] [UNIPROT]

Lineage

Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Pooideae; Triticeae; Hordeum; Hordeum vulgare

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

HSP90A
(Eukaryotic Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MATETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIP DKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTT KHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMVLYLKDDQMEYLEERRIKDLVKKHSEFISYPISLW TEKTTEKEISDDEDEEEKKDTEEGKVEDVDEEKEEKEKKKKKIKEVSHEWNLVNKQKPIWMRKPEEINKE EYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLFDNKKKANNIKLYVRRVFIMDNCDEL IPEYLSFVKGIVDSEDLPLNISRETLQQNKILKVIRKNLVKKCIELFFEIAENKEDYNKFYEAFSKNLKL GIHEDSQNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYE VIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKVIKEVLGDKVEKVI VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDK SVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCGACGGAGACCGAGACCTTCGCCTTCCAGGCCGAGATCAACCAGCTCCTCTCGCTCATCATCAACACCTTCTACTCCAACAAGGA
GATCTTTCTCCGCGAGCTCATCTCCAACTCCTCCGATGCCTTGGACAAGATCAGGTTCGAGAGCCTCACGGACAAGAGCAAGCTCGATGC
GCAGCCCGAGCTCTTCATCCACATCATCCCCGACAAGGCGACCAGCACGCTCACGATCGTCGACAGCGGCATTGGCATGACCAAGTCGGA
CCTCGTCAACAACCTCGGGACCATCGCCAGGTCGGGCACCAAGGAGTTCATGGAGGCTCTTGCCGCCGGCGCCGACGTGTCCATGATTGG
GCAGTTCGGTGTTGGGTTCTACTCCGCCTACCTTGTGGCCGAGAGGGTCGTCGTCACCACCAAGCACAACGACGACGAGCAGTACGTGTG
GGAGTCCCAGGCCGGTGGCTCCTTCACCGTCACTCGTGATACGTCTGGGGAGCAGCTCGGCAGGGGTACCAAGATGGTCCTCTACCTCAA
GGACGACCAGATGGAATACCTTGAGGAGCGCCGCATCAAGGATCTAGTTAAGAAGCACTCCGAGTTTATCAGCTACCCCATCTCCCTGTG
GACTGAGAAGACCACCGAGAAGGAAATTTCTGACGATGAAGACGAGGAGGAGAAGAAGGATACCGAGGAGGGCAAGGTTGAGGATGTTGA
TGAGGAGAAGGAAGAGAAGGAAAAGAAGAAAAAGAAGATCAAGGAAGTCTCTCATGAGTGGAACTTGGTCAACAAGCAGAAGCCTATCTG
GATGAGGAAGCCAGAGGAGATCAACAAGGAAGAGTATGCTGCTTTCTACAAGAGCTTGACCAATGACTGGGAGGAGCATTTGGCTGTCAA
GCACTTCTCTGTTGAGGGTCAGCTTGAGTTCAAGGCTGTCCTGTTTGTTCCCAAGAGGGCCCCCTTCGACCTCTTCGACAACAAGAAGAA
GGCCAACAACATCAAGCTGTATGTGCGCCGTGTCTTCATCATGGACAACTGTGATGAGTTGATCCCTGAGTACCTGAGCTTTGTCAAGGG
CATTGTTGATTCAGAGGACCTTCCCCTGAACATCTCCCGTGAGACTCTCCAGCAGAACAAGATCCTCAAGGTCATCCGGAAGAACCTTGT
CAAGAAGTGCATTGAGCTCTTCTTTGAGATTGCTGAGAACAAGGAGGACTACAACAAGTTCTACGAGGCCTTCTCCAAGAACCTCAAGCT
TGGCATCCATGAGGACTCCCAGAACAGGACCAAGATTGCTGAGCTTCTGAGGTACCACTCCACCAAGAGTGGTGATGAGCTGACGAGCCT
CAAGGACTATGTAACCAGGATGAAGGAGGGTCAGAACGAGATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTGGAGAACTCTCCCTT
CCTTGAGAAGCTGAAGAAGAAGGGCTATGAGGTCATCTACATGGTTGACGCCATTGATGAGTATGCCATTGGTCAGCTCAAGGAGTTTGA
GGGCAAGAAGCTTGTCTCTGCCACCAAGGAGGGTCTGAAGCTTGATGAGAGCGAGGACGAGAAGAAGAAGCAGGAGGAACTCAAGGAGAA
GTTCGAGGGGCTGTGCAAGGTCATCAAGGAGGTGCTGGGCGACAAGGTGGAGAAGGTCATCGTCTCTGACCGTGTTGTGGACTCACCGTG
CTGTCTGGTGACTGGTGAGTATGGGTGGACCGCCAACATGGAGAGGATCATGAAGGCCCAGGCCTTGAGGGACTCGAGCATGGCTGGCTA
CATGTCTAGCAAGAAGACCATGGAGATCAACCCTGAGAACGCCATCATGGACGAGCTCCGCAAGCGTGCCGACGCCGACAAGAACGACAA
GTCGGTGAAGGACCTGGTGATGCTTCTCTTCGAGACCTCCCTGCTCACCTCGGGCTTCAGCCTTGAGGACCCCAACACCTTCGGCACCAG
GATCCACCGCATGCTCAAGCTTGGCCTGAGCATTGATGAGGACGATGAGGCGCCTGAGAACGACACCGACATGCCGCCCCTGGAGGATGA
TGCCGGTGAGAGCAAGATGGAGGAGGTCGACTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine55427 %
Guanine60729 %
Thyamine40820 %
Cytosine53426 %
A+T96246 %
G+C114155 %

Total Bases :   2103 bases

Microsatellites
SequencePosition LengthRepeats
TCATCATCA5833
GTCGTCGTC40533
ACGACGACG42733
GAGGAGGAG67233
TCTCTC76623
AAGAAGAAG98133
GAAGAAGAA145133
AGAAGAAGA158833

Microsatellite Map

ATGGCGACGGAGACCGAGACCTTCGCCTTCCAGGCCGAGATCAACCAGCTCCTCTCGCTCATCATCAACACCTTCTACTCCAACAAGGAG
ATCTTTCTCCGCGAGCTCATCTCCAACTCCTCCGATGCCTTGGACAAGATCAGGTTCGAGAGCCTCACGGACAAGAGCAAGCTCGATGCG
CAGCCCGAGCTCTTCATCCACATCATCCCCGACAAGGCGACCAGCACGCTCACGATCGTCGACAGCGGCATTGGCATGACCAAGTCGGAC
CTCGTCAACAACCTCGGGACCATCGCCAGGTCGGGCACCAAGGAGTTCATGGAGGCTCTTGCCGCCGGCGCCGACGTGTCCATGATTGGG
CAGTTCGGTGTTGGGTTCTACTCCGCCTACCTTGTGGCCGAGAGGGTCGTCGTCACCACCAAGCACAACGACGACGAGCAGTACGTGTGG
GAGTCCCAGGCCGGTGGCTCCTTCACCGTCACTCGTGATACGTCTGGGGAGCAGCTCGGCAGGGGTACCAAGATGGTCCTCTACCTCAAG
GACGACCAGATGGAATACCTTGAGGAGCGCCGCATCAAGGATCTAGTTAAGAAGCACTCCGAGTTTATCAGCTACCCCATCTCCCTGTGG
ACTGAGAAGACCACCGAGAAGGAAATTTCTGACGATGAAGACGAGGAGGAGAAGAAGGATACCGAGGAGGGCAAGGTTGAGGATGTTGAT
GAGGAGAAGGAAGAGAAGGAAAAGAAGAAAAAGAAGATCAAGGAAGTCTCTCATGAGTGGAACTTGGTCAACAAGCAGAAGCCTATCTGG
ATGAGGAAGCCAGAGGAGATCAACAAGGAAGAGTATGCTGCTTTCTACAAGAGCTTGACCAATGACTGGGAGGAGCATTTGGCTGTCAAG
CACTTCTCTGTTGAGGGTCAGCTTGAGTTCAAGGCTGTCCTGTTTGTTCCCAAGAGGGCCCCCTTCGACCTCTTCGACAACAAGAAGAAG
GCCAACAACATCAAGCTGTATGTGCGCCGTGTCTTCATCATGGACAACTGTGATGAGTTGATCCCTGAGTACCTGAGCTTTGTCAAGGGC
ATTGTTGATTCAGAGGACCTTCCCCTGAACATCTCCCGTGAGACTCTCCAGCAGAACAAGATCCTCAAGGTCATCCGGAAGAACCTTGTC
AAGAAGTGCATTGAGCTCTTCTTTGAGATTGCTGAGAACAAGGAGGACTACAACAAGTTCTACGAGGCCTTCTCCAAGAACCTCAAGCTT
GGCATCCATGAGGACTCCCAGAACAGGACCAAGATTGCTGAGCTTCTGAGGTACCACTCCACCAAGAGTGGTGATGAGCTGACGAGCCTC
AAGGACTATGTAACCAGGATGAAGGAGGGTCAGAACGAGATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTGGAGAACTCTCCCTTC
CTTGAGAAGCTGAAGAAGAAGGGCTATGAGGTCATCTACATGGTTGACGCCATTGATGAGTATGCCATTGGTCAGCTCAAGGAGTTTGAG
GGCAAGAAGCTTGTCTCTGCCACCAAGGAGGGTCTGAAGCTTGATGAGAGCGAGGACGAGAAGAAGAAGCAGGAGGAACTCAAGGAGAAG
TTCGAGGGGCTGTGCAAGGTCATCAAGGAGGTGCTGGGCGACAAGGTGGAGAAGGTCATCGTCTCTGACCGTGTTGTGGACTCACCGTGC
TGTCTGGTGACTGGTGAGTATGGGTGGACCGCCAACATGGAGAGGATCATGAAGGCCCAGGCCTTGAGGGACTCGAGCATGGCTGGCTAC
ATGTCTAGCAAGAAGACCATGGAGATCAACCCTGAGAACGCCATCATGGACGAGCTCCGCAAGCGTGCCGACGCCGACAAGAACGACAAG
TCGGTGAAGGACCTGGTGATGCTTCTCTTCGAGACCTCCCTGCTCACCTCGGGCTTCAGCCTTGAGGACCCCAACACCTTCGGCACCAGG
ATCCACCGCATGCTCAAGCTTGGCCTGAGCATTGATGAGGACGATGAGGCGCCTGAGAACGACACCGACATGCCGCCCCTGGAGGATGAT
GCCGGTGAGAGCAAGATGGAGGAGGTCGACTAA

Gene Information
Molecule Type mRNA
Bases 2103 Bases
Molecular Weight651822.57 Da
Coding Sequence AY325266.1:68..2170
NCBI ReferenceAAP87284
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 4 to 216 213 ATPase domain of HSP90 chaperonee IPR003594
SSF55874
Variable Region 217 to 264 48 Segment linking N and M regions Manually identified
Middle Domain 265 to 520 256 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 543 to 665 123 C-terminal Domain of HSP90 SSF110942
coiled coil 223 to 261 39 Coiled Coil Region Manually identified
coiled coil 522 to 551 30 Coiled Coil Region Manually identified

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2JKI Jmol
2XCM Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP90_HOVU1

Accession Number

HSP90_0209

Added on

2012-02-02

Updated On

2014-01-20