Help  Custom Search
 
HSP90. of Plasmodium falciparum 3D7

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

HSP90.

Synonymous Names

Q8I0V4_PLAF7, Heat shock protein Hsp90, HSP90, Grp94, endoplasmin homolog.

Taxon Information

Organism

Plasmodium falciparum 3D7

Organism ID

36329 [NCBI] [UNIPROT]

Lineage

Eukaryota; Alveolata; Apicomplexa; Aconoidasida; Haemosporida; Plasmodium; Plasmodium (Laverania); Plasmodium falciparum

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

HSP90B/Grp94
(ER Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MQNVYVGNKIKFIILYFFCVLFLKDYERSEAFNLARTTEKLNYILNYKTPNRYDLNNNVNKLFFEKQKKK IEFSRKPLNSFNEDVKTIREDISSDSSPVEKYNFKAEVNKVMDIIVNSLYTDKDVFLRELISNASDACDK KRIILENNKLIKDAEVVTNEEIKNETEKEKTENVNESTDKKENVEEEKNDIKKLIIKIKPDKEKKTLTIT DNGIGMDKSELINNLGTIAQSGTAKFLKQIEEGKADSNLIGQFGVGFYSSFLVSNRVEVYTKKEDQIYRW SSDLKGSFSVNEIKKYDQEYDDIKGSGTKIILHLKEECDEYLEDYKLKELIKKYSEFIKFPIEIWSEKID YERVPDDSVSLKDGDKMKMKTITKRYHEWEKINVQLPIWKQDEKSLTENDYYSFYKNTFKAYDDPLAYVH FNVEGQISFNSILYIPGSLPWELSKNMFDEESRGIRLYVKRVFINDKFSESIPRWLTFLRGIVDSENLPL NVGREILQKSKMLSIINKRIVLKSISMMKGLKETGGDKWTKFLNTFGKYLKIGVVEDKENQEEIASLVEF YSINSGDKKTDLDSYIENMKEDQKCIYYISGENKKTAQNSPSLEKLKALNYDVLFSLEPIDEFCLSSLTV NKYKGYEVLDVNKADLKLKKENDQNKSDSLDKQKMEYEILCRWLHNKFSHKVHEVRISDRLINSPALLVQ GEMGMSPSMQKYMKQQATAQGISENEMFGGQSANQPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQI FDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKS TNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLD PSILNSNMLSGSDKTLL

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCAAAATGTTTATGTTGGGAACAAAATAAAATTTATAATATTGTACTTTTTTTGTGTGTTGTTTTTAAAAGATTATGAAAGAAGCGA
AGCTTTTAATTTAGCTCGTACTACGGAGAAATTGAACTATATATTAAATTACAAAACACCGAACAGATATGATTTAAATAACAATGTAAA
TAAATTATTTTTTGAAAAGCAAAAAAAGAAAATTGAGTTTAGTAGGAAACCTTTAAATAGTTTTAATGAGGATGTTAAAACCATTAGAGA
GGACATATCATCAGATAGTTCCCCTGTGGAAAAATATAATTTCAAAGCAGAGGTTAATAAAGTTATGGATATAATCGTTAATTCTTTATA
TACAGATAAGGATGTATTTTTGAGAGAATTAATTTCGAATGCATCTGATGCGTGTGATAAGAAAAGAATAATATTGGAAAATAATAAATT
AATAAAAGATGCTGAAGTAGTTACAAATGAGGAAATAAAAAATGAAACAGAAAAGGAAAAAACAGAAAATGTAAATGAATCAACAGATAA
AAAAGAAAACGTGGAAGAAGAAAAAAATGATATTAAGAAATTAATAATTAAAATAAAACCTGATAAAGAAAAAAAAACATTAACTATAAC
TGATAATGGTATAGGTATGGATAAAAGTGAATTAATTAATAATCTTGGTACGATAGCTCAATCGGGAACAGCTAAATTTTTAAAACAAAT
AGAAGAAGGAAAAGCAGATAGTAATTTAATAGGACAATTTGGTGTTGGTTTTTATTCTTCTTTTCTAGTATCTAATAGAGTTGAAGTATA
TACAAAAAAAGAAGATCAAATTTATCGATGGTCTTCAGATTTGAAAGGTAGTTTTAGTGTAAATGAAATTAAAAAATATGATCAAGAATA
TGATGATATTAAGGGTAGTGGAACCAAAATTATTTTACACTTAAAAGAAGAATGTGATGAATATTTAGAAGATTATAAATTAAAAGAATT
AATTAAAAAATATTCTGAGTTTATTAAATTCCCAATAGAAATATGGTCAGAAAAAATTGATTATGAAAGGGTTCCAGATGATTCTGTATC
ATTAAAAGATGGTGATAAAATGAAAATGAAAACAATTACAAAACGATATCATGAATGGGAAAAAATTAATGTACAATTACCAATATGGAA
ACAAGATGAAAAATCATTAACAGAAAATGATTATTATAGTTTTTATAAAAATACATTTAAAGCATATGATGATCCATTAGCTTATGTTCA
TTTTAATGTAGAAGGACAAATTTCTTTTAATTCCATTTTATATATTCCAGGTTCTTTACCATGGGAATTAAGTAAAAATATGTTTGACGA
AGAATCTAGAGGAATAAGATTATATGTAAAAAGAGTTTTTATAAATGACAAATTTTCTGAATCTATACCACGTTGGTTAACCTTTCTAAG
AGGTATTGTAGATAGTGAAAACTTACCATTAAATGTAGGAAGAGAAATATTACAAAAATCCAAAATGTTATCTATTATAAATAAAAGAAT
TGTACTCAAAAGTATTAGTATGATGAAAGGATTAAAAGAGACAGGAGGTGATAAATGGACTAAATTTCTTAACACATTTGGTAAATACCT
CAAAATTGGTGTTGTAGAAGATAAAGAAAATCAAGAAGAAATTGCATCATTAGTCGAATTTTATTCAATTAATAGTGGTGATAAAAAAAC
AGATCTTGATTCATATATAGAAAATATGAAAGAAGATCAAAAATGTATTTATTATATCTCAGGAGAAAATAAAAAAACCGCTCAGAATTC
TCCTTCTTTAGAAAAATTGAAAGCATTAAATTATGATGTTTTATTTTCTTTAGAACCAATTGATGAATTTTGTTTATCCTCTCTAACCGT
TAATAAATATAAAGGATATGAAGTCTTAGATGTAAATAAAGCCGACCTTAAGTTAAAAAAAGAAAATGATCAAAATAAATCCGACAGTTT
AGATAAACAGAAAATGGAATATGAAATATTATGTAGATGGCTACATAATAAATTTTCGCATAAAGTACATGAAGTACGAATTTCAGATCG
TTTGATAAATTCACCTGCTTTATTAGTTCAAGGTGAAATGGGTATGTCACCTTCTATGCAAAAATATATGAAACAACAAGCCACCGCTCA
AGGCATATCAGAAAATGAAATGTTTGGAGGCCAATCCGCAAATCAACCAGTATTAGAAATTAATCCTAACCATTTTATTATAAAACAATT
AAATCATTTAATACAAATTGATAAAATGAATTTACAAAATTCAGAAATTGCTGAACAAATATTTGATGTTGCATCAATGCAGGGAGGATA
TACTATAGATGATACCGGTCTCTTTGCCAAAAGAGTTATAGGCATGATGGAAAAAAATGCTGAACAATATTTAATGAATGTACAAAGTAA
TATATCAAACAATACATTAAATAATAATACATCTGGTTCGGAAATGCCACAAAACAATTCTCCAAATGAATTACAAAGTGAAATGAAATC
AACAAATGGAATTGATGATAATAGTAATATAAGCGAAAATAAAATTAATGAAAGCAGTTCCAATCAAAATAACATAGGCGAAAATAGCAT
TGCTGAAGAAAATAATATAAAGAACATAGCTGAGAGTGATGTGAATAAAATAAATTTAGGTGAAAATGATGTGAGCCAAAATACTATGCA
TAAACAGGATTCCGGTTTATTTAATTTAGATCCAAGTATTTTAAATAGTAATATGCTCAGTGGTTCTGATAAAACACTATTATAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine122344 %
Guanine44316 %
Thyamine84231 %
Cytosine27610 %
A+T206575 %
G+C71926 %

Total Bases :   2784 bases

Microsatellites
SequencePosition LengthRepeats
TTTTTT4823
GTGTGT5523
TATATA12623
TTTTTT18623
AAAAAA19923
AGAGAG26423
TATATA35523
GAGAGA38023
AAAAAA48523
AAAAAA50523
AAAAAA53723
GAAGAAGAA55233
AAAAAAAA60724
TATATA80523
AAAAAA81223
AAAAAA87923
AAAAAA99323
AAAAAA103923
AAAAAA113823
TATATA129723
AAAAAA170123
ATATAT172123
AAAAAA177923
CTCTCT187723
AAAAAA194323
ATATAT213223
AAAAAA238923
ATATAT242823
AATAATAAT244833

Microsatellite Map

ATGCAAAATGTTTATGTTGGGAACAAAATAAAATTTATAATATTGTACTTTTTTTGTGTGTTGTTTTTAAAAGATTATGAAAGAAGCGAA
GCTTTTAATTTAGCTCGTACTACGGAGAAATTGAACTATATATTAAATTACAAAACACCGAACAGATATGATTTAAATAACAATGTAAAT
AAATTATTTTTTGAAAAGCAAAAAAAGAAAATTGAGTTTAGTAGGAAACCTTTAAATAGTTTTAATGAGGATGTTAAAACCATTAGAGAG
GACATATCATCAGATAGTTCCCCTGTGGAAAAATATAATTTCAAAGCAGAGGTTAATAAAGTTATGGATATAATCGTTAATTCTTTATAT
ACAGATAAGGATGTATTTTTGAGAGAATTAATTTCGAATGCATCTGATGCGTGTGATAAGAAAAGAATAATATTGGAAAATAATAAATTA
ATAAAAGATGCTGAAGTAGTTACAAATGAGGAAATAAAAAATGAAACAGAAAAGGAAAAAACAGAAAATGTAAATGAATCAACAGATAAA
AAAGAAAACGTGGAAGAAGAAAAAAATGATATTAAGAAATTAATAATTAAAATAAAACCTGATAAAGAAAAAAAAACATTAACTATAACT
GATAATGGTATAGGTATGGATAAAAGTGAATTAATTAATAATCTTGGTACGATAGCTCAATCGGGAACAGCTAAATTTTTAAAACAAATA
GAAGAAGGAAAAGCAGATAGTAATTTAATAGGACAATTTGGTGTTGGTTTTTATTCTTCTTTTCTAGTATCTAATAGAGTTGAAGTATAT
ACAAAAAAAGAAGATCAAATTTATCGATGGTCTTCAGATTTGAAAGGTAGTTTTAGTGTAAATGAAATTAAAAAATATGATCAAGAATAT
GATGATATTAAGGGTAGTGGAACCAAAATTATTTTACACTTAAAAGAAGAATGTGATGAATATTTAGAAGATTATAAATTAAAAGAATTA
ATTAAAAAATATTCTGAGTTTATTAAATTCCCAATAGAAATATGGTCAGAAAAAATTGATTATGAAAGGGTTCCAGATGATTCTGTATCA
TTAAAAGATGGTGATAAAATGAAAATGAAAACAATTACAAAACGATATCATGAATGGGAAAAAATTAATGTACAATTACCAATATGGAAA
CAAGATGAAAAATCATTAACAGAAAATGATTATTATAGTTTTTATAAAAATACATTTAAAGCATATGATGATCCATTAGCTTATGTTCAT
TTTAATGTAGAAGGACAAATTTCTTTTAATTCCATTTTATATATTCCAGGTTCTTTACCATGGGAATTAAGTAAAAATATGTTTGACGAA
GAATCTAGAGGAATAAGATTATATGTAAAAAGAGTTTTTATAAATGACAAATTTTCTGAATCTATACCACGTTGGTTAACCTTTCTAAGA
GGTATTGTAGATAGTGAAAACTTACCATTAAATGTAGGAAGAGAAATATTACAAAAATCCAAAATGTTATCTATTATAAATAAAAGAATT
GTACTCAAAAGTATTAGTATGATGAAAGGATTAAAAGAGACAGGAGGTGATAAATGGACTAAATTTCTTAACACATTTGGTAAATACCTC
AAAATTGGTGTTGTAGAAGATAAAGAAAATCAAGAAGAAATTGCATCATTAGTCGAATTTTATTCAATTAATAGTGGTGATAAAAAAACA
GATCTTGATTCATATATAGAAAATATGAAAGAAGATCAAAAATGTATTTATTATATCTCAGGAGAAAATAAAAAAACCGCTCAGAATTCT
CCTTCTTTAGAAAAATTGAAAGCATTAAATTATGATGTTTTATTTTCTTTAGAACCAATTGATGAATTTTGTTTATCCTCTCTAACCGTT
AATAAATATAAAGGATATGAAGTCTTAGATGTAAATAAAGCCGACCTTAAGTTAAAAAAAGAAAATGATCAAAATAAATCCGACAGTTTA
GATAAACAGAAAATGGAATATGAAATATTATGTAGATGGCTACATAATAAATTTTCGCATAAAGTACATGAAGTACGAATTTCAGATCGT
TTGATAAATTCACCTGCTTTATTAGTTCAAGGTGAAATGGGTATGTCACCTTCTATGCAAAAATATATGAAACAACAAGCCACCGCTCAA
GGCATATCAGAAAATGAAATGTTTGGAGGCCAATCCGCAAATCAACCAGTATTAGAAATTAATCCTAACCATTTTATTATAAAACAATTA
AATCATTTAATACAAATTGATAAAATGAATTTACAAAATTCAGAAATTGCTGAACAAATATTTGATGTTGCATCAATGCAGGGAGGATAT
ACTATAGATGATACCGGTCTCTTTGCCAAAAGAGTTATAGGCATGATGGAAAAAAATGCTGAACAATATTTAATGAATGTACAAAGTAAT
ATATCAAACAATACATTAAATAATAATACATCTGGTTCGGAAATGCCACAAAACAATTCTCCAAATGAATTACAAAGTGAAATGAAATCA
ACAAATGGAATTGATGATAATAGTAATATAAGCGAAAATAAAATTAATGAAAGCAGTTCCAATCAAAATAACATAGGCGAAAATAGCATT
GCTGAAGAAAATAATATAAAGAACATAGCTGAGAGTGATGTGAATAAAATAAATTTAGGTGAAAATGATGTGAGCCAAAATACTATGCAT
AAACAGGATTCCGGTTTATTTAATTTAGATCCAAGTATTTTAAATAGTAATATGCTCAGTGGTTCTGATAAAACACTATTATAG

Gene Information
Molecule Type mRNA
Bases 2784 Bases
Molecular Weight864783.98 Da
Coding Sequence 1..2784
NCBI ReferenceXM_001348555
Notes Plasmodium falciparum 3D7 HSP90 (PF14_0417) mRNA; complete cds. HSP90

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
signal peptide 1 to 31 31 ER targeting peptide Manually identified
N-terminal Domain 98 to 351 254 ATPase domain of HSP90 chaperone IPR003594
SSF55874
Variable Region 352 to 383 32 Segment linking N and M regions Manually identified
Middle Domain 384 to 644 261 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 669 to 798 130 C-terminal Domain of HSP90 SSF110942
coiled coil 165 to 199 35 Coiled Coil Region Manually identified

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

3IED Jmol
1Y6Z Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

GRP94_PLFA2

Accession Number

HSP90_0126

Added on

2012-02-02

Updated On

2014-01-20