Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Bradyrhizobium japonicum str. USDA 110

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_BRAJA, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

bll7789

Gene Identifier

1048219

Taxon Information

Organism

Bradyrhizobium japonicum str. USDA 110

Organism ID

224911 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Bradyrhizobiaceae; Bradyrhizobium; Bradyrhizobium japonicum USDA 110

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MTTSDSAVHTQPFQAEVSELLHLMVHSVYSETDIFLRELVSNASDACDKLRYEAIESPALLGEGDALKIR IIPNKTAGTLTIADNGIGMERQELIDHLGTIARSGTKAFVSKLKEAKDGLGLIGQFGVGFYSAFMVADKI IVVSRRAGESDVWSWTSSGGSGFEIARASEEDAARVTRGTEIVLHLKDDAKKYLETYEIERIVGAYSDNI LFPIELVPEEGEPRQINSASALWQRSKSELSAEDYKKAYQQIASAFDDPAMTLHYRAEGRYSYAVLLFAP STKPFDLFEPSRKGRVRLYVRRVFITDDADLLPGYLRFIRGVVDSEDLPLNISREMLQNNPQLVQIRKAV ATRVVSELEGLAEKDAENFAKIWDAFGAVLKEGIYEDFERREKLLALSRFTTTTGEKRSLKQVVADFKPN QTEIYYLVGDSIERLKSNPRLEAATARGIEVLLLSDPVDAFWTSMPTEFEGKPLKSLSQGDLNLDLIPRV DATDEAKKDEPEADEAATIAVIKAALGERVSDVKASTRLTSSASCLVADSQGPSRELERILSQQNRGMRA KPVLEINLRHPMVGAITKAQAGSKAVDDLSLLLLEQAQILDGELPEDPAAFAARLNRLVLQGLGG

FASTA Format Composition Secondary Structure

Nucleotide
 ATGACGACGTCAGATTCAGCTGTGCATACGCAGCCCTTCCAGGCCGAGGTTTCCGAGCTGCTGCACCTCATGGTGCACTCCGTCTATTC
GGAGACCGACATCTTCCTGCGCGAGCTCGTCTCCAACGCCTCGGATGCCTGTGACAAGCTCCGCTACGAGGCGATCGAAAGTCCCGCGCT
GCTGGGCGAGGGCGACGCGCTCAAGATCCGCATCATCCCGAACAAGACGGCCGGAACGCTCACGATCGCCGATAACGGCATCGGCATGGA
GCGGCAGGAGCTGATCGACCATCTCGGCACCATCGCCCGCTCCGGCACCAAGGCGTTCGTCTCGAAGCTGAAGGAGGCCAAGGACGGCCT
CGGCCTGATCGGCCAGTTCGGCGTCGGCTTCTATTCCGCCTTCATGGTCGCCGACAAGATCATCGTGGTCAGCCGCCGCGCCGGCGAGAG
CGACGTCTGGAGCTGGACGTCCTCCGGCGGCTCCGGCTTCGAGATCGCGCGGGCCAGCGAGGAAGACGCGGCGCGCGTGACACGCGGCAC
CGAGATCGTCCTGCACCTGAAGGACGACGCCAAGAAATATCTCGAGACCTACGAGATCGAGCGCATCGTCGGTGCCTATTCCGACAACAT
CCTGTTTCCCATCGAGCTGGTGCCGGAAGAGGGCGAGCCGCGCCAGATCAACTCGGCGAGCGCGCTGTGGCAGCGATCGAAATCGGAGCT
TTCAGCCGAGGACTACAAGAAGGCCTATCAGCAGATCGCCTCCGCCTTCGACGACCCTGCGATGACGCTGCACTACCGCGCCGAGGGCCG
CTACTCCTACGCCGTGCTGCTGTTTGCGCCGTCGACAAAGCCGTTCGACCTGTTCGAGCCCTCGCGCAAGGGGCGCGTCAGGCTCTATGT
CCGCCGCGTCTTCATCACCGATGATGCCGATCTGCTCCCGGGCTATCTGCGCTTCATCCGCGGCGTCGTCGACAGCGAGGATCTTCCGCT
CAACATCTCGCGCGAGATGCTCCAGAACAATCCGCAGCTCGTGCAGATCCGCAAGGCCGTGGCGACCCGTGTCGTGTCCGAGCTCGAGGG
CCTCGCCGAGAAGGACGCGGAGAACTTCGCGAAGATCTGGGATGCTTTCGGCGCGGTGCTGAAAGAGGGCATCTACGAGGATTTCGAGCG
TCGCGAAAAGCTGCTGGCGCTGTCGCGCTTCACCACCACGACGGGCGAGAAGCGGTCGCTGAAGCAGGTTGTCGCCGATTTCAAGCCGAA
CCAGACCGAGATCTATTATCTCGTCGGTGACAGCATCGAACGGCTGAAGTCCAACCCGCGGCTCGAGGCGGCGACCGCGCGCGGCATCGA
GGTGCTGCTGCTGTCCGATCCGGTCGATGCCTTCTGGACCTCGATGCCGACGGAGTTCGAGGGCAAGCCGCTGAAGTCGCTGAGCCAGGG
CGATCTCAATCTCGACCTGATCCCGCGCGTCGACGCGACGGACGAGGCGAAGAAGGACGAGCCGGAGGCGGACGAGGCCGCCACCATCGC
GGTCATCAAGGCCGCCCTCGGCGAGCGCGTCAGCGACGTCAAGGCGTCCACGCGCCTCACCAGCTCGGCCTCCTGCCTCGTTGCCGACAG
CCAGGGTCCGAGCCGCGAACTCGAGCGTATCCTGTCGCAGCAGAACCGCGGCATGCGCGCCAAGCCGGTCCTCGAGATCAATCTGCGCCA
TCCGATGGTGGGGGCGATCACCAAGGCTCAGGCCGGCTCCAAGGCGGTCGACGATCTCAGCTTGCTCCTGCTCGAGCAGGCACAGATCCT
GGACGGCGAGTTGCCGGAGGACCCGGCGGCGTTTGCGGCGAGGTTGAACCGGCTCGTGTTGCAGGGGCTCGGCGGATAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine34819 %
Guanine60133 %
Thyamine31117 %
Cytosine61833 %
A+T65936 %
G+C121965 %

Total Bases :   1878 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG49423
GCGCGC51923
GCGCGC68823
CGCGCG99723
CACCACCAC119933
CGCGCGCG133424
TGCTGCTGC135133
CGCGCG146223
GCGCGC167323

Microsatellite Map

ATGACGACGTCAGATTCAGCTGTGCATACGCAGCCCTTCCAGGCCGAGGTTTCCGAGCTGCTGCACCTCATGGTGCACTCCGTCTATTCG
GAGACCGACATCTTCCTGCGCGAGCTCGTCTCCAACGCCTCGGATGCCTGTGACAAGCTCCGCTACGAGGCGATCGAAAGTCCCGCGCTG
CTGGGCGAGGGCGACGCGCTCAAGATCCGCATCATCCCGAACAAGACGGCCGGAACGCTCACGATCGCCGATAACGGCATCGGCATGGAG
CGGCAGGAGCTGATCGACCATCTCGGCACCATCGCCCGCTCCGGCACCAAGGCGTTCGTCTCGAAGCTGAAGGAGGCCAAGGACGGCCTC
GGCCTGATCGGCCAGTTCGGCGTCGGCTTCTATTCCGCCTTCATGGTCGCCGACAAGATCATCGTGGTCAGCCGCCGCGCCGGCGAGAGC
GACGTCTGGAGCTGGACGTCCTCCGGCGGCTCCGGCTTCGAGATCGCGCGGGCCAGCGAGGAAGACGCGGCGCGCGTGACACGCGGCACC
GAGATCGTCCTGCACCTGAAGGACGACGCCAAGAAATATCTCGAGACCTACGAGATCGAGCGCATCGTCGGTGCCTATTCCGACAACATC
CTGTTTCCCATCGAGCTGGTGCCGGAAGAGGGCGAGCCGCGCCAGATCAACTCGGCGAGCGCGCTGTGGCAGCGATCGAAATCGGAGCTT
TCAGCCGAGGACTACAAGAAGGCCTATCAGCAGATCGCCTCCGCCTTCGACGACCCTGCGATGACGCTGCACTACCGCGCCGAGGGCCGC
TACTCCTACGCCGTGCTGCTGTTTGCGCCGTCGACAAAGCCGTTCGACCTGTTCGAGCCCTCGCGCAAGGGGCGCGTCAGGCTCTATGTC
CGCCGCGTCTTCATCACCGATGATGCCGATCTGCTCCCGGGCTATCTGCGCTTCATCCGCGGCGTCGTCGACAGCGAGGATCTTCCGCTC
AACATCTCGCGCGAGATGCTCCAGAACAATCCGCAGCTCGTGCAGATCCGCAAGGCCGTGGCGACCCGTGTCGTGTCCGAGCTCGAGGGC
CTCGCCGAGAAGGACGCGGAGAACTTCGCGAAGATCTGGGATGCTTTCGGCGCGGTGCTGAAAGAGGGCATCTACGAGGATTTCGAGCGT
CGCGAAAAGCTGCTGGCGCTGTCGCGCTTCACCACCACGACGGGCGAGAAGCGGTCGCTGAAGCAGGTTGTCGCCGATTTCAAGCCGAAC
CAGACCGAGATCTATTATCTCGTCGGTGACAGCATCGAACGGCTGAAGTCCAACCCGCGGCTCGAGGCGGCGACCGCGCGCGGCATCGAG
GTGCTGCTGCTGTCCGATCCGGTCGATGCCTTCTGGACCTCGATGCCGACGGAGTTCGAGGGCAAGCCGCTGAAGTCGCTGAGCCAGGGC
GATCTCAATCTCGACCTGATCCCGCGCGTCGACGCGACGGACGAGGCGAAGAAGGACGAGCCGGAGGCGGACGAGGCCGCCACCATCGCG
GTCATCAAGGCCGCCCTCGGCGAGCGCGTCAGCGACGTCAAGGCGTCCACGCGCCTCACCAGCTCGGCCTCCTGCCTCGTTGCCGACAGC
CAGGGTCCGAGCCGCGAACTCGAGCGTATCCTGTCGCAGCAGAACCGCGGCATGCGCGCCAAGCCGGTCCTCGAGATCAATCTGCGCCAT
CCGATGGTGGGGGCGATCACCAAGGCTCAGGCCGGCTCCAAGGCGGTCGACGATCTCAGCTTGCTCCTGCTCGAGCAGGCACAGATCCTG
GACGGCGAGTTGCCGGAGGACCCGGCGGCGTTTGCGGCGAGGTTGAACCGGCTCGTGTTGCAGGGGCTCGGCGGATAG

Gene Information
Molecule Type genomic DNA
Bases 1878 Bases
Molecular Weight580109.77 Da
Coding Sequence complement(BA000040.2:8534059..8535936)
NCBI ReferenceBAC53054
Notesprobable chaperonine heat shock hsp90 proteins

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 7 to 223 217 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 228 to 480 253 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 507 to 621 115 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BRJA1

Accession Number

HSP90_0025

Added on

2012-02-02

Updated On

2014-01-20