Help  Custom Search
 
Chaperone protein HtpG. of Borrelia burgdorferi str. ZS7

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein HtpG.

Synonymous Names

B7J2C1_BORBZ, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Taxon Information

Organism

Borrelia burgdorferi str. ZS7

Organism ID

445985 [NCBI] [UNIPROT]

Lineage

Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Borrelia; Borrelia burgdorferi group; Borrelia burgdorferi ZS7

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MKKQFDTEVNDLLYLIIHSLYSHKEIFLRELISNASDAIDKLKFLSLTNEKFKNIALEPKIEISFDDKSI LIKDNGIGMDEQDLTNHLGVIAKSGTKEFINNLKQDEKKSASLIGQFGVGFYSAFIVSEKVEVTSKKALE SDAYIWSSDGKTGYEIEKAKKEESGTEIKLYLNKEGLEYANKWKIQEIIKKYSNHINYPIYIKYSEPIMK DGKQEGIEEKEEKLNETTALWTKNKSEIKAEEYNEFYKNTTFDYENPLMHIHTKAEGNLEYTNLFYVPSK APYDLYYPNTKPGVKLFINRIFITDSEGSLLPNYLRFIKGIIDCQDLPLNVSREILQQNKILSKIKSSSV KKILSELEKLSKKNPEKFSEFSKEFGRCIKEGVYSDFENREKLISLIRFKSSSVDGFVSFKEYKERMNES QKSIYYITGGKENILKENPIVAAYKEKGFEILIMDDELDEAILNLIPEYEGLKLKAINKNETSNELKDEN FKKIEEEFKDTLTKVKEILKDHIKEVNLSATLIKEPSAIIIDSNDPTYQMQKIMLSMGQEVKEIKPILEL NPNNKIVQNLKNLEPEKLEKISILLFEEAMLTSGMPSKNPGKFINIINEFIEKDFL

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAAAAAACAATTTGATACAGAAGTAAATGATTTGCTTTATTTAATCATCCACTCTCTTTACTCCCATAAAGAAATATTTTTAAGAGA
ATTGATATCAAATGCGTCTGACGCCATTGATAAACTCAAGTTTTTAAGCTTGACAAACGAAAAATTCAAAAACATTGCTCTAGAACCAAA
AATAGAAATATCGTTTGATGATAAAAGCATCCTAATTAAAGATAATGGAATCGGAATGGATGAACAAGATTTAACTAATCATCTTGGCGT
AATTGCAAAATCAGGAACTAAAGAATTTATTAACAATTTAAAACAAGATGAAAAAAAATCTGCAAGCCTAATTGGCCAGTTTGGAGTTGG
ATTTTACAGCGCATTCATAGTATCAGAAAAAGTAGAAGTTACATCAAAAAAAGCATTAGAAAGCGACGCATATATTTGGTCTAGCGACGG
CAAAACAGGATATGAAATAGAAAAAGCAAAAAAAGAAGAGTCAGGTACAGAAATAAAGTTATATCTTAATAAAGAAGGCCTTGAATATGC
TAATAAATGGAAAATTCAAGAAATTATCAAAAAATATTCAAATCACATAAATTATCCCATTTATATTAAATACAGCGAACCTATAATGAA
GGACGGGAAACAAGAGGGAATAGAAGAAAAAGAAGAAAAATTAAATGAAACTACTGCTCTTTGGACAAAAAATAAAAGCGAAATTAAAGC
AGAAGAATACAATGAATTTTATAAAAATACAACCTTTGATTATGAAAATCCATTAATGCATATTCATACAAAAGCCGAAGGAAATTTGGA
ATATACTAATTTATTTTACGTCCCAAGCAAAGCTCCCTATGATTTATATTACCCAAACACTAAGCCTGGGGTAAAGCTATTTATAAATAG
AATCTTTATTACAGATTCTGAAGGCAGCTTGCTTCCAAACTATCTAAGATTTATAAAAGGAATTATAGACTGCCAAGATTTGCCACTCAA
TGTAAGTAGAGAAATTTTACAGCAAAATAAAATTTTGTCTAAAATAAAATCATCTTCTGTAAAAAAAATACTAAGCGAGCTTGAAAAGCT
AAGTAAAAAAAATCCTGAAAAATTTTCAGAGTTTTCTAAAGAATTTGGGAGATGCATTAAAGAAGGTGTTTATTCTGACTTTGAAAACAG
AGAAAAGCTTATATCATTAATAAGGTTTAAATCCTCAAGTGTAGATGGGTTTGTGTCTTTTAAAGAGTATAAAGAAAGAATGAATGAGAG
TCAAAAAAGCATTTACTACATAACAGGCGGTAAAGAAAATATATTAAAAGAAAACCCAATAGTAGCTGCTTATAAAGAAAAAGGATTTGA
AATCTTAATCATGGACGATGAACTTGATGAAGCTATTTTAAATCTAATTCCAGAATACGAAGGATTAAAACTAAAGGCAATAAATAAAAA
CGAAACCAGCAATGAATTAAAAGATGAAAATTTCAAAAAAATTGAAGAAGAATTCAAAGATACCCTTACAAAAGTAAAAGAAATCCTCAA
GGATCATATAAAAGAAGTCAATCTATCAGCAACATTGATAAAAGAGCCTTCAGCAATAATAATTGATAGCAATGATCCAACTTACCAAAT
GCAAAAAATCATGCTGTCAATGGGACAAGAAGTAAAAGAAATAAAACCAATACTTGAATTAAACCCTAATAATAAAATAGTCCAAAATTT
AAAAAATCTAGAGCCTGAAAAATTAGAAAAAATAAGCATTCTCCTTTTTGAAGAAGCTATGTTAACTTCAGGAATGCCCAGCAAAAATCC
AGGAAAATTTATAAATATAATAAACGAATTTATAGAAAAAGACTTCTTATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine83746 %
Guanine27916 %
Thyamine48727 %
Cytosine24814 %
A+T132472 %
G+C52729 %

Total Bases :   1851 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA323
CTCTCT5323
AAAAAAAA31924
AAAAAA40423
ATATAT42823
AAAAAA47623
AAAAAA56723
AAAAAA69523
AAAAAAAA104924
AAAAAAAA108324
AAAAAA126123
ATATAT129723
AAAAAA147323
GAAGAAGAA148233
AATAATAAT158333
AAAAAA162123
TAATAATAA168533
AAAAAA170923
AAAAAA173523

Microsatellite Map

ATGAAAAAACAATTTGATACAGAAGTAAATGATTTGCTTTATTTAATCATCCACTCTCTTTACTCCCATAAAGAAATATTTTTAAGAGAA
TTGATATCAAATGCGTCTGACGCCATTGATAAACTCAAGTTTTTAAGCTTGACAAACGAAAAATTCAAAAACATTGCTCTAGAACCAAAA
ATAGAAATATCGTTTGATGATAAAAGCATCCTAATTAAAGATAATGGAATCGGAATGGATGAACAAGATTTAACTAATCATCTTGGCGTA
ATTGCAAAATCAGGAACTAAAGAATTTATTAACAATTTAAAACAAGATGAAAAAAAATCTGCAAGCCTAATTGGCCAGTTTGGAGTTGGA
TTTTACAGCGCATTCATAGTATCAGAAAAAGTAGAAGTTACATCAAAAAAAGCATTAGAAAGCGACGCATATATTTGGTCTAGCGACGGC
AAAACAGGATATGAAATAGAAAAAGCAAAAAAAGAAGAGTCAGGTACAGAAATAAAGTTATATCTTAATAAAGAAGGCCTTGAATATGCT
AATAAATGGAAAATTCAAGAAATTATCAAAAAATATTCAAATCACATAAATTATCCCATTTATATTAAATACAGCGAACCTATAATGAAG
GACGGGAAACAAGAGGGAATAGAAGAAAAAGAAGAAAAATTAAATGAAACTACTGCTCTTTGGACAAAAAATAAAAGCGAAATTAAAGCA
GAAGAATACAATGAATTTTATAAAAATACAACCTTTGATTATGAAAATCCATTAATGCATATTCATACAAAAGCCGAAGGAAATTTGGAA
TATACTAATTTATTTTACGTCCCAAGCAAAGCTCCCTATGATTTATATTACCCAAACACTAAGCCTGGGGTAAAGCTATTTATAAATAGA
ATCTTTATTACAGATTCTGAAGGCAGCTTGCTTCCAAACTATCTAAGATTTATAAAAGGAATTATAGACTGCCAAGATTTGCCACTCAAT
GTAAGTAGAGAAATTTTACAGCAAAATAAAATTTTGTCTAAAATAAAATCATCTTCTGTAAAAAAAATACTAAGCGAGCTTGAAAAGCTA
AGTAAAAAAAATCCTGAAAAATTTTCAGAGTTTTCTAAAGAATTTGGGAGATGCATTAAAGAAGGTGTTTATTCTGACTTTGAAAACAGA
GAAAAGCTTATATCATTAATAAGGTTTAAATCCTCAAGTGTAGATGGGTTTGTGTCTTTTAAAGAGTATAAAGAAAGAATGAATGAGAGT
CAAAAAAGCATTTACTACATAACAGGCGGTAAAGAAAATATATTAAAAGAAAACCCAATAGTAGCTGCTTATAAAGAAAAAGGATTTGAA
ATCTTAATCATGGACGATGAACTTGATGAAGCTATTTTAAATCTAATTCCAGAATACGAAGGATTAAAACTAAAGGCAATAAATAAAAAC
GAAACCAGCAATGAATTAAAAGATGAAAATTTCAAAAAAATTGAAGAAGAATTCAAAGATACCCTTACAAAAGTAAAAGAAATCCTCAAG
GATCATATAAAAGAAGTCAATCTATCAGCAACATTGATAAAAGAGCCTTCAGCAATAATAATTGATAGCAATGATCCAACTTACCAAATG
CAAAAAATCATGCTGTCAATGGGACAAGAAGTAAAAGAAATAAAACCAATACTTGAATTAAACCCTAATAATAAAATAGTCCAAAATTTA
AAAAATCTAGAGCCTGAAAAATTAGAAAAAATAAGCATTCTCCTTTTTGAAGAAGCTATGTTAACTTCAGGAATGCCCAGCAAAAATCCA
GGAAAATTTATAAATATAATAAACGAATTTATAGAAAAAGACTTCTTATAA

Gene Information
Molecule Type genomic DNA
Bases 1851 Bases
Molecular Weight573806.44 Da
Coding Sequence complement(CP001205.1:567925..569775)
NCBI ReferenceACK74539
Notesidentified by match to protein family HMM PF00183;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 1 to 206 206 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 226 to 480 255 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 500 to 613 114 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BOBU1

Accession Number

HSP90_0024

Added on

2012-02-02

Updated On

2014-01-20