Help  Custom Search
 
Heat shock protein 90. of Bordetella petrii str. DSM 12804

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90.

Synonymous Names

A9ICN4_BORPD, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

Bpet4336

Gene Identifier

5816514

Taxon Information

Organism

Bordetella petrii str. DSM 12804

Organism ID

340100 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Alcaligenaceae; Bordetella; Bordetella petrii DSM 12804

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MNQPATSSTPETLGFQAEVKQLLHLMIHSLYSNKEIFLRELVSNASDACDKLRFEAIDHPDLFGGDSDLA IRVDYDKAARTITISDNGIGLSRDEAIANLGTIARSGTREFFSQLTGDKQKDAQLIGQFGVGFYSSFIVA DKVTVTSRRAGAEAGEAVRWESDGQGEFTIVAADKPSRGTDVTLHLREDQDELLNGWKLREILRRYSDHI SLPIRMAKEEWDADKGEQVRRDELETVNQANALWTRSKGDITDEQYKEFYKTVSHDYDEPLAWTHNRVEG RSEYTQLLYVPKHAPFDLWDREGRRGVKLYVKRVFIMDDAEQLLPSYLRFVRGVIDSADLPLNVSREILQ ESRDVRAIREGSAKRVLSLLEDLAENKAEDYAAFWNEFGQVLKEGTGEDAGNLERIAKLLRFASTHSGDA AQTVSFADYVSRMKEGQDKIYYVTADSFAAASNSPHLEIFRKKGIEVLLLSDRVDEWMLSYLREFDGKSL VSVAKGGLDLAELADEDEKKRQSEVAESFKPLVERLQKALEDQVKEVRVTLRLVDSPACVVVGQNELSPH LLRMLKAAGQEAPDVKPVLEINPEHALIARVRDADDAEFEQWARLLLDQALLAEGAQIADPAAFVKRLNA LLLKA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAATCAACCCGCTACGTCCTCCACCCCCGAGACTCTGGGCTTTCAGGCCGAGGTGAAGCAGCTGCTGCACCTGATGATCCATTCGCT
GTACAGCAACAAGGAAATTTTCCTGCGCGAACTGGTGTCCAACGCGTCCGACGCCTGCGACAAGCTGCGCTTCGAGGCGATCGACCATCC
GGACCTGTTCGGGGGCGACAGCGACCTGGCCATCCGGGTCGATTATGACAAGGCGGCCCGCACCATTACTATTTCAGACAACGGCATCGG
CCTGTCGCGCGACGAGGCCATTGCCAACCTGGGCACGATTGCCCGGTCGGGCACGCGCGAGTTCTTCTCCCAGCTGACCGGCGACAAGCA
GAAAGATGCGCAGTTGATCGGCCAGTTCGGCGTGGGCTTTTATTCGTCGTTCATCGTTGCCGACAAGGTCACCGTGACCAGCCGGCGGGC
CGGCGCCGAGGCGGGCGAGGCCGTTCGCTGGGAATCCGACGGCCAGGGCGAGTTCACCATCGTGGCCGCCGACAAGCCGTCGCGCGGCAC
CGACGTCACGCTGCACCTGCGCGAAGACCAGGACGAACTGCTCAACGGCTGGAAGCTGCGCGAGATTCTGCGCCGCTATTCCGACCATAT
CTCGCTGCCGATCCGCATGGCCAAGGAAGAATGGGATGCCGACAAGGGCGAGCAGGTCAGGCGCGATGAGCTGGAGACAGTCAACCAGGC
CAACGCGCTGTGGACGCGCAGCAAGGGCGACATTACCGACGAGCAGTACAAAGAGTTCTACAAGACGGTGTCGCACGACTACGACGAACC
GCTGGCCTGGACGCACAACCGCGTGGAAGGGCGCAGCGAGTACACGCAGCTGCTGTATGTGCCCAAGCACGCGCCCTTCGACCTGTGGGA
CCGCGAGGGCCGCCGCGGCGTGAAGCTGTATGTGAAGCGCGTGTTCATTATGGACGACGCTGAACAACTGCTGCCGTCGTACCTGCGCTT
TGTGCGCGGGGTGATCGATTCGGCCGACCTGCCCCTGAACGTGTCGCGCGAGATTCTGCAGGAAAGCCGCGACGTGCGCGCCATACGCGA
AGGGTCGGCCAAGCGGGTGCTGTCGCTGCTGGAAGACCTGGCCGAGAACAAGGCCGAAGACTACGCCGCGTTCTGGAACGAGTTCGGCCA
GGTGCTGAAGGAAGGCACGGGCGAAGACGCCGGCAACCTGGAGCGTATTGCCAAGCTGCTGCGCTTCGCGTCTACCCATTCGGGCGATGC
GGCGCAGACGGTGTCGTTTGCCGACTACGTGTCGCGCATGAAAGAAGGGCAGGACAAGATCTACTACGTTACGGCCGACAGTTTCGCCGC
CGCCAGCAACAGCCCGCACCTGGAGATTTTCCGCAAGAAAGGCATCGAAGTGCTGCTGCTTTCGGATCGCGTCGACGAATGGATGTTGTC
GTATCTGCGCGAGTTCGACGGCAAGTCGCTCGTGTCGGTGGCCAAGGGTGGCCTGGACCTGGCCGAACTGGCTGACGAAGACGAGAAGAA
GCGCCAGTCGGAAGTGGCCGAGAGCTTCAAGCCGCTGGTCGAGCGTCTGCAGAAGGCACTGGAAGACCAGGTGAAGGAAGTTCGCGTGAC
GCTGCGCCTGGTGGATTCGCCCGCTTGCGTGGTGGTGGGCCAGAACGAGCTCAGCCCGCACTTGCTGCGCATGCTGAAAGCAGCCGGCCA
AGAGGCGCCTGACGTGAAGCCGGTGCTGGAAATCAACCCCGAACACGCCTTGATCGCGCGCGTGCGCGATGCCGACGACGCCGAGTTCGA
GCAATGGGCGCGGCTGTTGCTGGACCAGGCCCTGCTCGCCGAAGGCGCGCAAATCGCCGACCCGGCGGCGTTCGTCAAGCGCTTGAATGC
GTTGCTGTTGAAGGCATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine38521 %
Guanine63234 %
Thyamine31817 %
Cytosine57331 %
A+T70337 %
G+C120564 %

Total Bases :   1908 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG27423
CGCGCG32223
CGCGCG52923
CGCGCG103323
GCGCGC106423
CGCCGCCGC134333
TGCTGCTGC139933
GTGGTGGTG164733
CGCGCGCG176324
GCGCGC184323

Microsatellite Map

ATGAATCAACCCGCTACGTCCTCCACCCCCGAGACTCTGGGCTTTCAGGCCGAGGTGAAGCAGCTGCTGCACCTGATGATCCATTCGCTG
TACAGCAACAAGGAAATTTTCCTGCGCGAACTGGTGTCCAACGCGTCCGACGCCTGCGACAAGCTGCGCTTCGAGGCGATCGACCATCCG
GACCTGTTCGGGGGCGACAGCGACCTGGCCATCCGGGTCGATTATGACAAGGCGGCCCGCACCATTACTATTTCAGACAACGGCATCGGC
CTGTCGCGCGACGAGGCCATTGCCAACCTGGGCACGATTGCCCGGTCGGGCACGCGCGAGTTCTTCTCCCAGCTGACCGGCGACAAGCAG
AAAGATGCGCAGTTGATCGGCCAGTTCGGCGTGGGCTTTTATTCGTCGTTCATCGTTGCCGACAAGGTCACCGTGACCAGCCGGCGGGCC
GGCGCCGAGGCGGGCGAGGCCGTTCGCTGGGAATCCGACGGCCAGGGCGAGTTCACCATCGTGGCCGCCGACAAGCCGTCGCGCGGCACC
GACGTCACGCTGCACCTGCGCGAAGACCAGGACGAACTGCTCAACGGCTGGAAGCTGCGCGAGATTCTGCGCCGCTATTCCGACCATATC
TCGCTGCCGATCCGCATGGCCAAGGAAGAATGGGATGCCGACAAGGGCGAGCAGGTCAGGCGCGATGAGCTGGAGACAGTCAACCAGGCC
AACGCGCTGTGGACGCGCAGCAAGGGCGACATTACCGACGAGCAGTACAAAGAGTTCTACAAGACGGTGTCGCACGACTACGACGAACCG
CTGGCCTGGACGCACAACCGCGTGGAAGGGCGCAGCGAGTACACGCAGCTGCTGTATGTGCCCAAGCACGCGCCCTTCGACCTGTGGGAC
CGCGAGGGCCGCCGCGGCGTGAAGCTGTATGTGAAGCGCGTGTTCATTATGGACGACGCTGAACAACTGCTGCCGTCGTACCTGCGCTTT
GTGCGCGGGGTGATCGATTCGGCCGACCTGCCCCTGAACGTGTCGCGCGAGATTCTGCAGGAAAGCCGCGACGTGCGCGCCATACGCGAA
GGGTCGGCCAAGCGGGTGCTGTCGCTGCTGGAAGACCTGGCCGAGAACAAGGCCGAAGACTACGCCGCGTTCTGGAACGAGTTCGGCCAG
GTGCTGAAGGAAGGCACGGGCGAAGACGCCGGCAACCTGGAGCGTATTGCCAAGCTGCTGCGCTTCGCGTCTACCCATTCGGGCGATGCG
GCGCAGACGGTGTCGTTTGCCGACTACGTGTCGCGCATGAAAGAAGGGCAGGACAAGATCTACTACGTTACGGCCGACAGTTTCGCCGCC
GCCAGCAACAGCCCGCACCTGGAGATTTTCCGCAAGAAAGGCATCGAAGTGCTGCTGCTTTCGGATCGCGTCGACGAATGGATGTTGTCG
TATCTGCGCGAGTTCGACGGCAAGTCGCTCGTGTCGGTGGCCAAGGGTGGCCTGGACCTGGCCGAACTGGCTGACGAAGACGAGAAGAAG
CGCCAGTCGGAAGTGGCCGAGAGCTTCAAGCCGCTGGTCGAGCGTCTGCAGAAGGCACTGGAAGACCAGGTGAAGGAAGTTCGCGTGACG
CTGCGCCTGGTGGATTCGCCCGCTTGCGTGGTGGTGGGCCAGAACGAGCTCAGCCCGCACTTGCTGCGCATGCTGAAAGCAGCCGGCCAA
GAGGCGCCTGACGTGAAGCCGGTGCTGGAAATCAACCCCGAACACGCCTTGATCGCGCGCGTGCGCGATGCCGACGACGCCGAGTTCGAG
CAATGGGCGCGGCTGTTGCTGGACCAGGCCCTGCTCGCCGAAGGCGCGCAAATCGCCGACCCGGCGGCGTTCGTCAAGCGCTTGAATGCG
TTGCTGTTGAAGGCATAA

Gene Information
Molecule Type genomic DNA
Bases 1908 Bases
Molecular Weight591020.35 Da
Coding Sequence complement(AM902716.1:4593775..4595682)
NCBI ReferenceCAP44687
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 9 to 223 215 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 239 to 496 258 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 521 to 634 114 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BOPT1

Accession Number

HSP90_0023

Added on

2012-02-02

Updated On

2014-01-20