Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Bordetella pertussis str. Tohama I

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_BORPE, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

BP0074

Gene Identifier

2666131

Taxon Information

Organism

Bordetella pertussis str. Tohama I

Organism ID

257313 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Alcaligenaceae;Bordetella; Bordetella pertussis Tohama I

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MSQTTTTSASETLGFQAEVKQLLHLMIHSLYSNKEIFLRELVSNASDACDKLRFEAIDQPGLLEGDGELA IRVGYDKAARTITISDNGIGLSRDEAVANLGTIARSGTREFFSQLTGDKQKDAQLIGQFGVGFYSSFIVA DKVTVLSRRAGLAANEAIRWESDGQGEFSIAPAEKAGRGTDVVLHLRADEDELLNGWKLREILRRYSDHI SLPIRMAKEDWDAEKGEQVKGDELETVNQANALWTRNKSDITDEQYREFYKTVSHDYDDPLAWTHNRVEG RSEYTQLLYVPKHAPFDLWDRDARRGVKLYVKRVFIMDDAEQLLPSYLRFVRGVIDSADLPLNVSREILQ ESRDVRAIREGSAKRVLSLLEDMAENKAEDYATFWTEFGQVLKEGTGEDAANRERIARLLRFASTHDGEQ AQTVSFADYVGRMKDGQDKIYYVTADTFTAAANSPHLEIFRKKGIEVLLLSDRVDEWMLSYLREFDGKSL VSVAKGGLDLAELADEEEKKRQSEVAETFKPLVERLQQALAEQVKEVRVTQRLVDSPACVVVGQNELSPH LLRMLKAAGQEAPEVKPVLEINPDHALVARIRDASDAEFGDWAALLLDQALLAEGAQIADPAAFVKRLNG LLLKA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGCCAGACCACCACGACTTCCGCATCCGAAACCCTGGGGTTCCAGGCCGAGGTGAAGCAGCTGCTGCACCTGATGATTCACTCTCT
CTACAGCAACAAGGAGATCTTCCTGCGCGAGCTGGTGTCGAACGCGTCGGACGCGTGCGACAAGCTGCGCTTCGAGGCGATCGACCAGCC
GGGCTTGCTGGAAGGCGACGGGGAGCTGGCGATCCGGGTGGGTTACGACAAGGCCGCCCGCACGATCACGATTTCCGATAACGGTATCGG
CCTGTCGCGCGACGAGGCGGTGGCCAATCTGGGCACGATTGCCCGCTCGGGCACGCGCGAGTTTTTCTCGCAGCTGACGGGCGACAAGCA
GAAGGACGCGCAGCTGATCGGCCAGTTCGGGGTGGGGTTCTATTCCTCGTTCATCGTGGCCGACAAGGTGACGGTGCTGAGCCGCCGCGC
CGGCCTGGCGGCCAATGAGGCGATCCGCTGGGAGTCGGACGGGCAGGGCGAGTTCAGCATCGCGCCGGCCGAGAAGGCCGGGCGCGGTAC
GGATGTGGTGCTGCACTTGCGCGCCGACGAGGACGAGTTGCTCAATGGTTGGAAGCTGCGCGAGATCCTGCGCCGCTATTCGGACCATAT
TTCGCTGCCGATCCGCATGGCCAAGGAGGATTGGGACGCGGAGAAGGGCGAGCAGGTCAAGGGCGATGAGCTGGAGACGGTGAACCAGGC
GAATGCGCTGTGGACGCGCAACAAATCGGATATTACCGACGAGCAGTATCGCGAGTTCTACAAAACGGTGTCGCACGATTATGACGATCC
GCTGGCGTGGACGCATAACCGGGTGGAGGGCCGCAGCGAGTATACGCAGCTGCTGTATGTGCCCAAGCATGCGCCGTTCGATCTGTGGGA
CCGCGATGCGCGCCGCGGGGTGAAGCTGTATGTGAAGCGGGTGTTCATCATGGACGACGCGGAGCAGTTGCTGCCGTCGTATCTGCGTTT
CGTGCGCGGGGTGATCGATTCGGCGGATTTGCCGCTGAACGTGTCGCGCGAGATCCTGCAGGAGAGCCGCGATGTGCGGGCGATCCGCGA
GGGTTCGGCCAAGCGGGTGCTGTCGCTGCTGGAGGACATGGCGGAGAACAAGGCGGAGGATTACGCGACGTTCTGGACGGAGTTCGGCCA
GGTGCTGAAGGAAGGCACGGGCGAGGACGCGGCCAACCGCGAGCGCATCGCCAGGCTGCTGCGCTTTGCGTCGACGCACGATGGCGAGCA
GGCGCAGACGGTGTCGTTCGCGGATTATGTGGGCCGCATGAAGGATGGCCAGGACAAGATTTACTACGTGACGGCGGATACGTTCACGGC
GGCGGCGAACAGTCCGCACCTGGAGATTTTCCGGAAGAAGGGCATCGAGGTGCTGCTGCTGTCGGATCGGGTGGACGAGTGGATGCTGTC
CTATCTGCGCGAGTTCGACGGCAAGTCGCTGGTGTCGGTGGCCAAGGGCGGCCTGGATCTGGCGGAGTTGGCGGACGAAGAAGAGAAGAA
GCGTCAGTCCGAGGTGGCCGAGACGTTCAAGCCGCTGGTCGAGCGCCTGCAGCAGGCGCTGGCCGAGCAGGTGAAGGAGGTGCGGGTGAC
GCAGCGCCTGGTGGATTCTCCGGCCTGCGTGGTGGTGGGCCAGAACGAGCTCAGCCCGCATCTGCTGCGCATGCTGAAGGCGGCCGGCCA
GGAGGCGCCGGAGGTCAAGCCGGTGCTGGAGATCAACCCGGACCACGCGCTGGTCGCGCGGATCCGCGATGCCAGCGATGCGGAGTTCGG
CGATTGGGCCGCGCTGCTGCTGGACCAGGCGCTGCTGGCCGAAGGCGCGCAGATCGCCGACCCGGCGGCCTTCGTGAAGCGCTTGAATGG
GTTGCTGTTGAAGGCTTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine34719 %
Guanine72238 %
Thyamine32618 %
Cytosine51327 %
A+T67336 %
G+C123565 %

Total Bases :   1908 bases

Microsatellites
SequencePosition LengthRepeats
CTCTCTCT8324
CGCGCG27423
CGCGCG32223
GCGCGC55723
GCGCGC90623
CGCGCG103323
CGGCGGCGG134533
TGCTGCTGC139933
GTGGTGGTG164733
CGCGCG176323
GCTGCTGCT181133
GCGCGC184323

Microsatellite Map

ATGAGCCAGACCACCACGACTTCCGCATCCGAAACCCTGGGGTTCCAGGCCGAGGTGAAGCAGCTGCTGCACCTGATGATTCACTCTCTC
TACAGCAACAAGGAGATCTTCCTGCGCGAGCTGGTGTCGAACGCGTCGGACGCGTGCGACAAGCTGCGCTTCGAGGCGATCGACCAGCCG
GGCTTGCTGGAAGGCGACGGGGAGCTGGCGATCCGGGTGGGTTACGACAAGGCCGCCCGCACGATCACGATTTCCGATAACGGTATCGGC
CTGTCGCGCGACGAGGCGGTGGCCAATCTGGGCACGATTGCCCGCTCGGGCACGCGCGAGTTTTTCTCGCAGCTGACGGGCGACAAGCAG
AAGGACGCGCAGCTGATCGGCCAGTTCGGGGTGGGGTTCTATTCCTCGTTCATCGTGGCCGACAAGGTGACGGTGCTGAGCCGCCGCGCC
GGCCTGGCGGCCAATGAGGCGATCCGCTGGGAGTCGGACGGGCAGGGCGAGTTCAGCATCGCGCCGGCCGAGAAGGCCGGGCGCGGTACG
GATGTGGTGCTGCACTTGCGCGCCGACGAGGACGAGTTGCTCAATGGTTGGAAGCTGCGCGAGATCCTGCGCCGCTATTCGGACCATATT
TCGCTGCCGATCCGCATGGCCAAGGAGGATTGGGACGCGGAGAAGGGCGAGCAGGTCAAGGGCGATGAGCTGGAGACGGTGAACCAGGCG
AATGCGCTGTGGACGCGCAACAAATCGGATATTACCGACGAGCAGTATCGCGAGTTCTACAAAACGGTGTCGCACGATTATGACGATCCG
CTGGCGTGGACGCATAACCGGGTGGAGGGCCGCAGCGAGTATACGCAGCTGCTGTATGTGCCCAAGCATGCGCCGTTCGATCTGTGGGAC
CGCGATGCGCGCCGCGGGGTGAAGCTGTATGTGAAGCGGGTGTTCATCATGGACGACGCGGAGCAGTTGCTGCCGTCGTATCTGCGTTTC
GTGCGCGGGGTGATCGATTCGGCGGATTTGCCGCTGAACGTGTCGCGCGAGATCCTGCAGGAGAGCCGCGATGTGCGGGCGATCCGCGAG
GGTTCGGCCAAGCGGGTGCTGTCGCTGCTGGAGGACATGGCGGAGAACAAGGCGGAGGATTACGCGACGTTCTGGACGGAGTTCGGCCAG
GTGCTGAAGGAAGGCACGGGCGAGGACGCGGCCAACCGCGAGCGCATCGCCAGGCTGCTGCGCTTTGCGTCGACGCACGATGGCGAGCAG
GCGCAGACGGTGTCGTTCGCGGATTATGTGGGCCGCATGAAGGATGGCCAGGACAAGATTTACTACGTGACGGCGGATACGTTCACGGCG
GCGGCGAACAGTCCGCACCTGGAGATTTTCCGGAAGAAGGGCATCGAGGTGCTGCTGCTGTCGGATCGGGTGGACGAGTGGATGCTGTCC
TATCTGCGCGAGTTCGACGGCAAGTCGCTGGTGTCGGTGGCCAAGGGCGGCCTGGATCTGGCGGAGTTGGCGGACGAAGAAGAGAAGAAG
CGTCAGTCCGAGGTGGCCGAGACGTTCAAGCCGCTGGTCGAGCGCCTGCAGCAGGCGCTGGCCGAGCAGGTGAAGGAGGTGCGGGTGACG
CAGCGCCTGGTGGATTCTCCGGCCTGCGTGGTGGTGGGCCAGAACGAGCTCAGCCCGCATCTGCTGCGCATGCTGAAGGCGGCCGGCCAG
GAGGCGCCGGAGGTCAAGCCGGTGCTGGAGATCAACCCGGACCACGCGCTGGTCGCGCGGATCCGCGATGCCAGCGATGCGGAGTTCGGC
GATTGGGCCGCGCTGCTGCTGGACCAGGCGCTGCTGGCCGAAGGCGCGCAGATCGCCGACCCGGCGGCCTTCGTGAAGCGCTTGAATGGG
TTGCTGTTGAAGGCTTGA

Gene Information
Molecule Type genomic DNA
Bases 1908 Bases
Molecular Weight593830.07 Da
Coding Sequence BX640411.1:71637..73544
NCBI ReferenceCAE40453
NotesSimilar to Escherichia coli heat shock protein HtpG

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 9 to 223 215 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 239 to 496 258 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 521 to 634 114 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BOPE1

Accession Number

HSP90_0022

Added on

2012-02-02

Updated On

2014-01-20