Help  Custom Search
 
Chaperone protein HtpG. of Bordetella avium str. 197N

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein HtpG.

Synonymous Names

HTPG_BORA1, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

BAV0447

Gene Identifier

6264750

Taxon Information

Organism

Bordetella avium str. 197N

Organism ID

360910 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Alcaligenaceae; Bordetella; Bordetella avium 197N

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MTQNATSETLGFQAEVKQLLHLMIHSLYSNKEIFLRELVSNASDACDKLRFEAIDQPELLAGDSELAIRV SYDKAARTITIADNGIGLSREEAIANLGTIARSGTREFFSQLTGDKQKDAQLIGQFGVGFYSSFIVADRV SVLSRRAGSDEAIRWESDGQGEFSIASAEKATRGTDVVLHLRADEDEFLNGWKLREVLRRYSDHISLPIL MRKEEWDADKDEQVTRDEWETVNQANALWTRSKSEISDEQYREFYKTVSHGFDEPLAWTHNRVEGRSEYT QLLYVPRQAPFDLWDRDARRGVKLYVKRVFIMDDAEQLLPAYLRFVRGVIDSADLPLNVSREILQESRDV RAIREGSAKRILSLLEDLAENRKDDYAVFWGEFGQVLKEGVGEDPSNQERIAKLLRFASTHAGDASQTTS LQDYLGRLKEGQDKIYYVTADSYSAASNSPHLEIFRKKGIEVLLLWDRVDEWMLSHLREFEGKSLVSVAK GGLDLADLADEEEKKKQTEVAESFKPLIERLQTALGEQVKEVRVTLRLVDSPACVVVGQNDLSPHLLRML KAAGQEVPEVKPVLEINPEHALIARIRDVSDADFGAWAQLLLDQALLAEGAQIADPAAFVKRLNALLLKV

FASTA Format Composition Secondary Structure

Nucleotide
 ATGACTCAAAATGCCACGTCCGAAACCCTGGGGTTCCAGGCTGAGGTCAAGCAGTTGCTGCACCTGATGATCCATTCCTTGTATAGCAA
CAAGGAAATTTTCTTGCGCGAGCTGGTCTCGAACGCATCGGATGCCTGCGACAAGCTGCGCTTTGAAGCCATCGATCAGCCTGAGCTGCT
GGCGGGCGATAGCGAGCTGGCGATCCGCGTGAGCTATGACAAGGCGGCGCGCACGATCACGATCGCCGATAACGGCATCGGCCTGTCGCG
CGAAGAGGCCATCGCCAATCTGGGCACAATCGCTCGCTCGGGCACGCGCGAGTTTTTCTCGCAACTGACGGGCGACAAGCAAAAAGACGC
CCAGTTGATCGGTCAGTTCGGCGTGGGCTTTTATTCGTCGTTCATCGTGGCGGACCGGGTCAGCGTGCTGAGCCGCCGCGCCGGTTCCGA
TGAGGCGATCCGCTGGGAATCCGACGGCCAGGGCGAGTTCTCGATTGCATCGGCCGAGAAGGCCACGCGGGGCACGGATGTCGTGCTGCA
TCTGCGCGCCGACGAGGATGAGTTTCTGAATGGCTGGAAGCTGCGCGAGGTGCTGCGCCGCTATTCCGACCATATTTCGCTGCCCATTCT
GATGCGCAAGGAAGAGTGGGACGCCGACAAGGACGAGCAGGTCACGCGGGATGAGTGGGAGACGGTCAATCAGGCCAATGCGCTCTGGAC
CCGCTCCAAGAGCGAGATCTCCGATGAGCAGTACCGCGAGTTCTACAAGACGGTGTCGCACGGCTTTGATGAGCCGCTGGCCTGGACGCA
TAACCGCGTGGAAGGCCGCAGTGAGTATACGCAGCTGCTCTATGTGCCGCGTCAGGCGCCCTTTGATCTGTGGGACCGCGATGCCCGCCG
CGGCGTGAAGCTGTATGTGAAGCGGGTGTTCATCATGGATGACGCCGAGCAGCTGCTGCCGGCCTATCTGCGCTTTGTGCGTGGGGTGAT
CGATTCGGCGGATCTGCCGCTGAATGTGTCGCGCGAAATCTTGCAGGAAAGCCGGGATGTCCGCGCGATCCGCGAGGGCTCGGCCAAGCG
CATTTTGTCGCTGCTGGAAGACCTGGCCGAGAACCGCAAGGACGATTACGCGGTGTTCTGGGGCGAGTTTGGCCAGGTGCTGAAGGAAGG
CGTGGGCGAAGATCCGTCTAACCAGGAGCGCATTGCCAAACTGCTGCGTTTTGCATCGACCCATGCGGGAGATGCGTCGCAGACGACGTC
GCTGCAAGATTATCTGGGCCGTCTGAAAGAAGGCCAGGACAAGATCTATTACGTGACGGCCGACAGCTATTCGGCCGCCAGCAACAGCCC
GCATCTGGAGATTTTCCGCAAGAAGGGCATCGAGGTGCTGCTCTTGTGGGACCGCGTGGACGAGTGGATGCTGTCGCATCTGCGCGAATT
CGAGGGCAAGTCGCTGGTGTCGGTGGCCAAGGGCGGTCTGGATCTGGCCGATCTGGCGGACGAGGAAGAAAAGAAAAAGCAGACCGAGGT
GGCCGAGTCTTTCAAGCCGCTGATCGAGCGCTTGCAAACGGCGCTGGGAGAGCAGGTCAAAGAGGTGCGTGTCACCCTGCGCCTGGTGGA
CTCGCCTGCCTGCGTGGTGGTGGGCCAGAATGATTTGAGCCCGCATTTGCTGCGCATGCTCAAGGCGGCCGGCCAGGAAGTGCCCGAGGT
CAAGCCGGTGCTGGAGATCAACCCGGAGCACGCCCTGATCGCCCGTATCCGCGACGTTTCCGATGCGGATTTCGGCGCCTGGGCGCAGTT
GTTGCTGGATCAGGCGCTGCTGGCCGAAGGCGCGCAGATCGCCGATCCGGCGGCCTTTGTGAAGCGCCTGAATGCGCTGCTGCTGAAGGT
ATGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine36620 %
Guanine64735 %
Thyamine36420 %
Cytosine51628 %
A+T73039 %
G+C116362 %

Total Bases :   1893 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC22523
CGCGCG26523
CGCGCG31323
GCGCGC54223
CGCGCG101823
CGCGCG105023
GTGGTGGTG163233
GCGCGC182823
GCTGCTGCT187433

Microsatellite Map

ATGACTCAAAATGCCACGTCCGAAACCCTGGGGTTCCAGGCTGAGGTCAAGCAGTTGCTGCACCTGATGATCCATTCCTTGTATAGCAAC
AAGGAAATTTTCTTGCGCGAGCTGGTCTCGAACGCATCGGATGCCTGCGACAAGCTGCGCTTTGAAGCCATCGATCAGCCTGAGCTGCTG
GCGGGCGATAGCGAGCTGGCGATCCGCGTGAGCTATGACAAGGCGGCGCGCACGATCACGATCGCCGATAACGGCATCGGCCTGTCGCGC
GAAGAGGCCATCGCCAATCTGGGCACAATCGCTCGCTCGGGCACGCGCGAGTTTTTCTCGCAACTGACGGGCGACAAGCAAAAAGACGCC
CAGTTGATCGGTCAGTTCGGCGTGGGCTTTTATTCGTCGTTCATCGTGGCGGACCGGGTCAGCGTGCTGAGCCGCCGCGCCGGTTCCGAT
GAGGCGATCCGCTGGGAATCCGACGGCCAGGGCGAGTTCTCGATTGCATCGGCCGAGAAGGCCACGCGGGGCACGGATGTCGTGCTGCAT
CTGCGCGCCGACGAGGATGAGTTTCTGAATGGCTGGAAGCTGCGCGAGGTGCTGCGCCGCTATTCCGACCATATTTCGCTGCCCATTCTG
ATGCGCAAGGAAGAGTGGGACGCCGACAAGGACGAGCAGGTCACGCGGGATGAGTGGGAGACGGTCAATCAGGCCAATGCGCTCTGGACC
CGCTCCAAGAGCGAGATCTCCGATGAGCAGTACCGCGAGTTCTACAAGACGGTGTCGCACGGCTTTGATGAGCCGCTGGCCTGGACGCAT
AACCGCGTGGAAGGCCGCAGTGAGTATACGCAGCTGCTCTATGTGCCGCGTCAGGCGCCCTTTGATCTGTGGGACCGCGATGCCCGCCGC
GGCGTGAAGCTGTATGTGAAGCGGGTGTTCATCATGGATGACGCCGAGCAGCTGCTGCCGGCCTATCTGCGCTTTGTGCGTGGGGTGATC
GATTCGGCGGATCTGCCGCTGAATGTGTCGCGCGAAATCTTGCAGGAAAGCCGGGATGTCCGCGCGATCCGCGAGGGCTCGGCCAAGCGC
ATTTTGTCGCTGCTGGAAGACCTGGCCGAGAACCGCAAGGACGATTACGCGGTGTTCTGGGGCGAGTTTGGCCAGGTGCTGAAGGAAGGC
GTGGGCGAAGATCCGTCTAACCAGGAGCGCATTGCCAAACTGCTGCGTTTTGCATCGACCCATGCGGGAGATGCGTCGCAGACGACGTCG
CTGCAAGATTATCTGGGCCGTCTGAAAGAAGGCCAGGACAAGATCTATTACGTGACGGCCGACAGCTATTCGGCCGCCAGCAACAGCCCG
CATCTGGAGATTTTCCGCAAGAAGGGCATCGAGGTGCTGCTCTTGTGGGACCGCGTGGACGAGTGGATGCTGTCGCATCTGCGCGAATTC
GAGGGCAAGTCGCTGGTGTCGGTGGCCAAGGGCGGTCTGGATCTGGCCGATCTGGCGGACGAGGAAGAAAAGAAAAAGCAGACCGAGGTG
GCCGAGTCTTTCAAGCCGCTGATCGAGCGCTTGCAAACGGCGCTGGGAGAGCAGGTCAAAGAGGTGCGTGTCACCCTGCGCCTGGTGGAC
TCGCCTGCCTGCGTGGTGGTGGGCCAGAATGATTTGAGCCCGCATTTGCTGCGCATGCTCAAGGCGGCCGGCCAGGAAGTGCCCGAGGTC
AAGCCGGTGCTGGAGATCAACCCGGAGCACGCCCTGATCGCCCGTATCCGCGACGTTTCCGATGCGGATTTCGGCGCCTGGGCGCAGTTG
TTGCTGGATCAGGCGCTGCTGGCCGAAGGCGCGCAGATCGCCGATCCGGCGGCCTTTGTGAAGCGCCTGAATGCGCTGCTGCTGAAGGTA
TGA

Gene Information
Molecule Type genomic DNA
Bases 1893 Bases
Molecular Weight587517.45 Da
Coding Sequence AM167904.1:447783..449675
NCBI ReferenceCAJ48052
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 6 to 218 213 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 234 to 491 258 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 516 to 629 114 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BOAV1

Accession Number

HSP90_0021

Added on

2012-02-02

Updated On

2014-01-20