Help  Custom Search
 
Heat shock protein Hsp90. of Beijerinckia indica subsp. indica ATCC 9039

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein Hsp90.

Synonymous Names

B2IH62_BEII9, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Taxon Information

Organism

Beijerinckia indica subsp. indica ATCC 9039

Organism ID

395963 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Beijerinckia; Beijerinckia indica subsp. indica ATCC 9039

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MTEATEHKSSGESQVFQADVAKLLHLMVHSIYSDRDIFLRELLSNGADACEKLRYEALAHPELAPSPFAI KIRIDKEGRRLIIEDNGVGMSRADLADSLGTIARSGTKAFLEALGEQGQNTKAEDQETETEADKPQKAGP GTDLIGQFGIGFYSAFMVADHVDVTSRRAGSNEAFNWSSDGKGTFTIVPVPVEDAPAPGTRVMLHINEAS QTYLEPYEIERIVREHSSALAVPIEIIEKNQEGVEEPRRLTDGAALWTKPKSAITPEEYTEFYRDVAGQY DEPALTIHWRAEGRHEYTVLAFIPNSRPFDLFDPARKGRGRLYVRRVLITQDAELVPHWLRFVRLVVDSA DLPLNVSREMIQESPVFAAIKKGVTNRILQELTKLADSEPEKFAKIWEHFGAVIKEGLYEDAERRDSLFK IARFATSSHAEGGRTLKDYVAGLRENQTAIYYLLGDDLKRLAVSPQLEGFRKRGIEVLLLADHVDAFWVS TAVGFDGKPFKSITQGAADIKNVPSLENEEDKAAEPPPGGLAALFAFMKQTLGDMVEDVRASDRLSESPA CLIASDLGPDRQLERMLAEHGQLGRLAKPVLEINPTHPLIKALNEDLTSPDKEKLEDIVWLLLDEARLME GDQPADAPHFASRLTRILLKAAQKASA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGACCGAGGCCACGGAGCACAAGAGCTCTGGAGAATCGCAAGTTTTTCAGGCAGATGTCGCCAAGCTTTTGCACCTTATGGTGCATTC
CATCTATTCCGATCGCGATATTTTCCTGCGTGAGCTTCTTTCGAACGGCGCCGACGCCTGTGAAAAGCTACGTTATGAAGCCCTGGCCCA
TCCAGAACTGGCTCCCTCTCCCTTCGCCATCAAAATCAGGATCGACAAGGAAGGCCGACGGCTGATCATCGAGGATAATGGCGTTGGCAT
GTCGCGCGCCGATCTCGCCGATTCGCTCGGCACGATCGCCCGTTCCGGCACCAAGGCCTTTCTCGAAGCCTTGGGTGAGCAAGGCCAAAA
CACAAAAGCCGAGGATCAGGAGACCGAGACGGAAGCCGACAAGCCGCAAAAGGCTGGACCTGGCACCGATCTCATCGGCCAGTTCGGCAT
TGGCTTCTATTCGGCCTTCATGGTCGCCGATCACGTCGACGTCACGAGCCGCCGCGCCGGCTCGAACGAGGCTTTTAACTGGAGTTCCGA
CGGCAAGGGCACCTTCACCATCGTTCCTGTCCCGGTCGAGGATGCGCCCGCGCCCGGCACGCGCGTCATGCTGCACATCAACGAAGCCTC
GCAAACCTATCTCGAACCCTATGAAATCGAACGCATCGTGCGCGAACATTCGAGCGCGCTCGCCGTACCAATCGAAATCATCGAGAAAAA
TCAGGAAGGCGTAGAGGAACCCCGCCGCCTGACCGATGGCGCCGCCCTCTGGACCAAGCCCAAAAGCGCGATCACGCCGGAAGAATATAC
GGAATTCTACCGCGACGTCGCCGGCCAATATGACGAGCCGGCCCTCACCATCCATTGGCGGGCTGAGGGACGGCACGAATATACGGTGCT
CGCCTTCATCCCGAATTCGCGGCCCTTCGACCTTTTCGATCCCGCCCGCAAGGGACGCGGCCGGCTTTATGTCCGTCGCGTGCTGATCAC
CCAGGATGCCGAACTGGTACCGCACTGGCTGCGTTTCGTCCGGCTGGTGGTCGATTCAGCCGATCTGCCGCTAAATGTCTCACGCGAGAT
GATTCAGGAAAGCCCCGTCTTCGCGGCGATCAAGAAAGGCGTCACCAATCGCATCCTGCAAGAATTGACCAAGCTCGCCGACAGTGAGCC
GGAGAAATTCGCCAAGATCTGGGAGCATTTCGGCGCGGTCATCAAGGAAGGCCTTTACGAGGACGCTGAGCGCCGCGACAGCCTTTTCAA
AATCGCGCGCTTTGCCACCTCGTCCCATGCCGAGGGTGGCCGTACCTTGAAGGATTATGTCGCCGGTCTGCGCGAGAATCAGACGGCCAT
CTATTATCTTCTCGGCGATGATCTGAAGCGCCTCGCCGTGAGCCCGCAGCTCGAAGGCTTCCGCAAGCGCGGGATCGAAGTTCTGCTGCT
TGCCGACCATGTCGATGCTTTCTGGGTGTCAACCGCCGTTGGCTTCGACGGCAAGCCGTTTAAATCGATCACGCAGGGCGCGGCCGATAT
CAAGAACGTGCCCTCGCTCGAGAATGAGGAGGACAAGGCGGCGGAGCCACCTCCCGGCGGCCTCGCGGCTTTATTTGCCTTCATGAAGCA
AACGCTTGGCGATATGGTCGAGGATGTACGCGCTTCCGATCGTCTGTCGGAAAGCCCAGCCTGTCTCATCGCCTCGGACCTTGGTCCCGA
CCGGCAGTTGGAACGCATGCTCGCCGAACATGGTCAGCTCGGGCGTCTCGCCAAGCCGGTCCTCGAAATCAACCCGACGCATCCATTGAT
CAAGGCCCTGAACGAGGATCTCACCAGTCCCGACAAGGAAAAGCTCGAGGATATCGTCTGGCTTCTGCTCGATGAGGCCCGTCTGATGGA
AGGCGACCAGCCGGCGGACGCGCCCCATTTCGCAAGCCGTCTCACCCGCATCCTCCTAAAGGCTGCACAAAAGGCCTCGGCATGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine42222 %
Guanine55128 %
Thyamine37620 %
Cytosine62532 %
A+T79841 %
G+C117660 %

Total Bases :   1974 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG27123
CGCGCG59823
GCGCGC68223
CGCGCG126223

Microsatellite Map

ATGACCGAGGCCACGGAGCACAAGAGCTCTGGAGAATCGCAAGTTTTTCAGGCAGATGTCGCCAAGCTTTTGCACCTTATGGTGCATTCC
ATCTATTCCGATCGCGATATTTTCCTGCGTGAGCTTCTTTCGAACGGCGCCGACGCCTGTGAAAAGCTACGTTATGAAGCCCTGGCCCAT
CCAGAACTGGCTCCCTCTCCCTTCGCCATCAAAATCAGGATCGACAAGGAAGGCCGACGGCTGATCATCGAGGATAATGGCGTTGGCATG
TCGCGCGCCGATCTCGCCGATTCGCTCGGCACGATCGCCCGTTCCGGCACCAAGGCCTTTCTCGAAGCCTTGGGTGAGCAAGGCCAAAAC
ACAAAAGCCGAGGATCAGGAGACCGAGACGGAAGCCGACAAGCCGCAAAAGGCTGGACCTGGCACCGATCTCATCGGCCAGTTCGGCATT
GGCTTCTATTCGGCCTTCATGGTCGCCGATCACGTCGACGTCACGAGCCGCCGCGCCGGCTCGAACGAGGCTTTTAACTGGAGTTCCGAC
GGCAAGGGCACCTTCACCATCGTTCCTGTCCCGGTCGAGGATGCGCCCGCGCCCGGCACGCGCGTCATGCTGCACATCAACGAAGCCTCG
CAAACCTATCTCGAACCCTATGAAATCGAACGCATCGTGCGCGAACATTCGAGCGCGCTCGCCGTACCAATCGAAATCATCGAGAAAAAT
CAGGAAGGCGTAGAGGAACCCCGCCGCCTGACCGATGGCGCCGCCCTCTGGACCAAGCCCAAAAGCGCGATCACGCCGGAAGAATATACG
GAATTCTACCGCGACGTCGCCGGCCAATATGACGAGCCGGCCCTCACCATCCATTGGCGGGCTGAGGGACGGCACGAATATACGGTGCTC
GCCTTCATCCCGAATTCGCGGCCCTTCGACCTTTTCGATCCCGCCCGCAAGGGACGCGGCCGGCTTTATGTCCGTCGCGTGCTGATCACC
CAGGATGCCGAACTGGTACCGCACTGGCTGCGTTTCGTCCGGCTGGTGGTCGATTCAGCCGATCTGCCGCTAAATGTCTCACGCGAGATG
ATTCAGGAAAGCCCCGTCTTCGCGGCGATCAAGAAAGGCGTCACCAATCGCATCCTGCAAGAATTGACCAAGCTCGCCGACAGTGAGCCG
GAGAAATTCGCCAAGATCTGGGAGCATTTCGGCGCGGTCATCAAGGAAGGCCTTTACGAGGACGCTGAGCGCCGCGACAGCCTTTTCAAA
ATCGCGCGCTTTGCCACCTCGTCCCATGCCGAGGGTGGCCGTACCTTGAAGGATTATGTCGCCGGTCTGCGCGAGAATCAGACGGCCATC
TATTATCTTCTCGGCGATGATCTGAAGCGCCTCGCCGTGAGCCCGCAGCTCGAAGGCTTCCGCAAGCGCGGGATCGAAGTTCTGCTGCTT
GCCGACCATGTCGATGCTTTCTGGGTGTCAACCGCCGTTGGCTTCGACGGCAAGCCGTTTAAATCGATCACGCAGGGCGCGGCCGATATC
AAGAACGTGCCCTCGCTCGAGAATGAGGAGGACAAGGCGGCGGAGCCACCTCCCGGCGGCCTCGCGGCTTTATTTGCCTTCATGAAGCAA
ACGCTTGGCGATATGGTCGAGGATGTACGCGCTTCCGATCGTCTGTCGGAAAGCCCAGCCTGTCTCATCGCCTCGGACCTTGGTCCCGAC
CGGCAGTTGGAACGCATGCTCGCCGAACATGGTCAGCTCGGGCGTCTCGCCAAGCCGGTCCTCGAAATCAACCCGACGCATCCATTGATC
AAGGCCCTGAACGAGGATCTCACCAGTCCCGACAAGGAAAAGCTCGAGGATATCGTCTGGCTTCTGCTCGATGAGGCCCGTCTGATGGAA
GGCGACCAGCCGGCGGACGCGCCCCATTTCGCAAGCCGTCTCACCCGCATCCTCCTAAAGGCTGCACAAAAGGCCTCGGCATGA

Gene Information
Molecule Type genomic DNA
Bases 1974 Bases
Molecular Weight608624.07 Da
Coding Sequence complement(CP001016.1:922049..924022)
NCBI ReferenceACB94476
NotesPFAM: heat shock protein Hsp90; ATP-binding region

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 10 to 243 234 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 252 to 506 255 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 533 to 650 118 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BEIN1

Accession Number

HSP90_0020

Added on

2012-02-02

Updated On

2014-01-20