Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Bdellovibrio bacteriovorus str. HD100

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_BDEBA, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

Bd1806

Gene Identifier

2734915

Taxon Information

Organism

Bdellovibrio bacteriovorus str. HD100

Organism ID

264462 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Deltaproteobacteria; Bdellovibrionales; Bdellovibrionaceae; Bdellovibrio; Bdellovibrio bacteriovorus HD100

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MAKQVQNFNAEIKQLLDIVIHSLYSHKEIFLRELLSNASDAIDKLKFNSLTHPSLLPENWQPAIRLEPNS ETKTLKIIDNGIGMTQEEVVEFIGTIARSGAKAFMQMNAEMKTKPELIGQFGVGFYSAFMVADRVTLHTQ KAGSNDGTVWESMGDGTYSLDSVPRPEGTGTTITLHMKDFKEEDEVQNFTDKWVLKSLVKKYSDFIAHPI KMMGETEEETLNSQKALWLKSPSEVTKEEYKEFYQHLTHDWNEPLRTVHYRAEGTMEFNALLYVPGKKPW NYNMRDMEYGLSLYIKRVFIMADCKDLLPPYLRFVKGLVDSSDLSLNVSRELLQQDRQVTQIRKNVTNKA LSTLKDLLTKERSAYEDFWTEFGATLKEGLPSDAANKEKLQDLLLFHSTSSDKMTTMDEYVARMKETQKD IYYITGDSLSQVSNSPYLEKLKEKGFEVLLLVDPVDEWVVDALSEFKGKKLQSIMREGLDLDTAEEKQQK EQEKKQAEVTLKPVLESMKKTLESDVKDVVLSDRLTNTPACLVASSADPSAHMQKLMAQMGKEYAGQQVK RIMEINPNHPVFEKMLKASPEQQTKWAEILYAQALLTEGSNLPDPVKFSQQIAELMVQAADSTKH

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCCAAGCAGGTTCAAAACTTTAACGCTGAAATCAAACAACTTCTGGATATCGTGATCCACTCCCTTTATTCGCACAAAGAGATCTT
TTTGCGCGAACTTTTGTCCAACGCGTCTGATGCGATCGACAAACTGAAATTCAACTCTTTGACTCACCCGTCTTTGCTTCCGGAAAACTG
GCAGCCGGCGATCCGCCTGGAGCCAAACTCTGAGACCAAGACCCTGAAGATCATCGATAACGGTATCGGCATGACCCAGGAAGAAGTTGT
CGAGTTCATCGGCACCATCGCCCGTTCCGGCGCCAAAGCCTTCATGCAGATGAATGCGGAAATGAAGACCAAACCGGAACTGATCGGTCA
ATTCGGTGTGGGCTTCTATTCTGCTTTTATGGTCGCGGACCGCGTGACCCTGCACACACAAAAAGCTGGCAGCAATGACGGCACGGTGTG
GGAATCCATGGGGGATGGAACATATTCACTGGACAGCGTTCCCCGTCCGGAAGGCACTGGCACCACCATCACTTTGCACATGAAGGACTT
CAAGGAAGAAGACGAAGTCCAGAATTTCACCGACAAGTGGGTCCTGAAATCCCTGGTGAAAAAGTATTCTGACTTTATCGCTCACCCAAT
CAAGATGATGGGCGAAACGGAAGAAGAAACACTGAACTCGCAAAAAGCTCTTTGGTTGAAATCCCCATCCGAAGTGACCAAAGAAGAATA
CAAGGAATTCTATCAGCATTTGACCCATGACTGGAACGAGCCTCTGCGCACGGTTCACTATCGCGCGGAAGGCACGATGGAATTCAATGC
CCTTCTTTATGTTCCTGGCAAAAAGCCATGGAACTACAACATGCGCGACATGGAATACGGCCTGAGCCTTTACATCAAGCGTGTGTTTAT
CATGGCTGACTGCAAAGACCTTCTGCCTCCTTACCTGCGTTTTGTAAAAGGCCTGGTGGACAGCAGTGATTTGTCTTTGAACGTATCCCG
TGAATTGCTTCAGCAGGACCGTCAGGTCACGCAGATCCGCAAGAACGTGACCAATAAGGCTCTTTCCACTTTGAAAGATCTTTTGACCAA
AGAGCGCTCAGCTTATGAAGACTTCTGGACTGAATTTGGTGCGACTTTGAAAGAAGGTCTGCCGTCCGACGCGGCTAACAAAGAAAAGCT
TCAGGATCTGTTGCTGTTCCACTCCACGTCCTCTGACAAGATGACGACTATGGATGAATACGTGGCGCGCATGAAAGAAACCCAGAAGGA
TATTTACTATATTACGGGCGATTCCCTTTCCCAGGTTTCAAACAGCCCGTACCTTGAGAAGCTGAAAGAAAAAGGCTTTGAGGTTCTGTT
GCTGGTGGATCCGGTGGACGAATGGGTTGTCGATGCTTTGAGTGAATTCAAAGGCAAAAAACTGCAATCCATCATGCGTGAAGGTCTGGA
CCTGGACACGGCTGAAGAAAAACAGCAAAAGGAACAGGAAAAGAAACAGGCCGAAGTCACTTTGAAACCTGTATTGGAATCCATGAAGAA
GACTTTGGAAAGCGATGTGAAAGACGTGGTTCTTTCAGACCGCTTAACGAACACCCCAGCGTGTCTGGTGGCTTCTTCTGCCGACCCTTC
CGCACACATGCAAAAACTGATGGCGCAAATGGGGAAAGAGTACGCGGGTCAGCAGGTCAAACGCATCATGGAGATCAACCCGAACCACCC
GGTGTTTGAAAAGATGCTGAAGGCTTCTCCAGAGCAGCAAACCAAATGGGCGGAAATCCTTTATGCCCAGGCTTTGCTGACCGAAGGCTC
CAACCTTCCCGACCCAGTGAAGTTCTCTCAGCAGATCGCGGAACTGATGGTGCAGGCTGCGGATAGTACCAAACACTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine53529 %
Guanine46225 %
Thyamine41723 %
Cytosine46425 %
A+T95251 %
G+C92650 %

Total Bases :   1878 bases

Microsatellites
SequencePosition LengthRepeats
CACACACA41124
GAAGAAGAA64833
CGCGCG78023
GTGTGT88923
GCGCGC123323
AAAAAA140423
CACACA162123
TCTCTC182223

Microsatellite Map

ATGGCCAAGCAGGTTCAAAACTTTAACGCTGAAATCAAACAACTTCTGGATATCGTGATCCACTCCCTTTATTCGCACAAAGAGATCTTT
TTGCGCGAACTTTTGTCCAACGCGTCTGATGCGATCGACAAACTGAAATTCAACTCTTTGACTCACCCGTCTTTGCTTCCGGAAAACTGG
CAGCCGGCGATCCGCCTGGAGCCAAACTCTGAGACCAAGACCCTGAAGATCATCGATAACGGTATCGGCATGACCCAGGAAGAAGTTGTC
GAGTTCATCGGCACCATCGCCCGTTCCGGCGCCAAAGCCTTCATGCAGATGAATGCGGAAATGAAGACCAAACCGGAACTGATCGGTCAA
TTCGGTGTGGGCTTCTATTCTGCTTTTATGGTCGCGGACCGCGTGACCCTGCACACACAAAAAGCTGGCAGCAATGACGGCACGGTGTGG
GAATCCATGGGGGATGGAACATATTCACTGGACAGCGTTCCCCGTCCGGAAGGCACTGGCACCACCATCACTTTGCACATGAAGGACTTC
AAGGAAGAAGACGAAGTCCAGAATTTCACCGACAAGTGGGTCCTGAAATCCCTGGTGAAAAAGTATTCTGACTTTATCGCTCACCCAATC
AAGATGATGGGCGAAACGGAAGAAGAAACACTGAACTCGCAAAAAGCTCTTTGGTTGAAATCCCCATCCGAAGTGACCAAAGAAGAATAC
AAGGAATTCTATCAGCATTTGACCCATGACTGGAACGAGCCTCTGCGCACGGTTCACTATCGCGCGGAAGGCACGATGGAATTCAATGCC
CTTCTTTATGTTCCTGGCAAAAAGCCATGGAACTACAACATGCGCGACATGGAATACGGCCTGAGCCTTTACATCAAGCGTGTGTTTATC
ATGGCTGACTGCAAAGACCTTCTGCCTCCTTACCTGCGTTTTGTAAAAGGCCTGGTGGACAGCAGTGATTTGTCTTTGAACGTATCCCGT
GAATTGCTTCAGCAGGACCGTCAGGTCACGCAGATCCGCAAGAACGTGACCAATAAGGCTCTTTCCACTTTGAAAGATCTTTTGACCAAA
GAGCGCTCAGCTTATGAAGACTTCTGGACTGAATTTGGTGCGACTTTGAAAGAAGGTCTGCCGTCCGACGCGGCTAACAAAGAAAAGCTT
CAGGATCTGTTGCTGTTCCACTCCACGTCCTCTGACAAGATGACGACTATGGATGAATACGTGGCGCGCATGAAAGAAACCCAGAAGGAT
ATTTACTATATTACGGGCGATTCCCTTTCCCAGGTTTCAAACAGCCCGTACCTTGAGAAGCTGAAAGAAAAAGGCTTTGAGGTTCTGTTG
CTGGTGGATCCGGTGGACGAATGGGTTGTCGATGCTTTGAGTGAATTCAAAGGCAAAAAACTGCAATCCATCATGCGTGAAGGTCTGGAC
CTGGACACGGCTGAAGAAAAACAGCAAAAGGAACAGGAAAAGAAACAGGCCGAAGTCACTTTGAAACCTGTATTGGAATCCATGAAGAAG
ACTTTGGAAAGCGATGTGAAAGACGTGGTTCTTTCAGACCGCTTAACGAACACCCCAGCGTGTCTGGTGGCTTCTTCTGCCGACCCTTCC
GCACACATGCAAAAACTGATGGCGCAAATGGGGAAAGAGTACGCGGGTCAGCAGGTCAAACGCATCATGGAGATCAACCCGAACCACCCG
GTGTTTGAAAAGATGCTGAAGGCTTCTCCAGAGCAGCAAACCAAATGGGCGGAAATCCTTTATGCCCAGGCTTTGCTGACCGAAGGCTCC
AACCTTCCCGACCCAGTGAAGTTCTCTCAGCAGATCGCGGAACTGATGGTGCAGGCTGCGGATAGTACCAAACACTAA

Gene Information
Molecule Type genomic DNA
Bases 1878 Bases
Molecular Weight580631.33 Da
Coding Sequence complement(BX842650.1:341386..343263)
NCBI ReferenceCAE79666
Noteshypothetical protein

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 2 to 219 218 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 223 to 477 255 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 503 to 618 116 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BDBA1

Accession Number

HSP90_0019

Added on

2012-02-02

Updated On

2014-01-20