Help  Custom Search
 
putative heat-shock protein. of Bacteroides fragilis str. NCTC 9343

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

putative heat-shock protein.

Synonymous Names

Q5LIQ5_BACFN, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Taxon Information

Organism

Bacteroides fragilis str. NCTC 9343

Organism ID

272559 [NCBI] [UNIPROT]

Lineage

Bacteria; Bacteroidetes; Bacteroidia; Bacteroidales; Bacteroidaceae;Bacteroides; Bacteroides fragilis NCTC 9343

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MEKEGNNLFQVNLKGMIALLSEHIYSNPNTFVRELLQNSVDAITALHNIDENYSGRIDVFLNGDGSMVFQ DNGIGLKEEEVYRFLTVIGESSKRDTPDADDFIGRFGIGLLSCFVVTNEIRVESRSAMGGNPVCWCGKVD GTYQTTFPDEEWEIGSRVVLRPKNEWAHLFEYEVFKKILVNYGEVLPYPVYLHGGEEEELVNTPSPVWLD PKATRKELLDYGTKVFQSSALDAFPIRTEHGRIEGVLYVLPFRTQFSVRNSHKVYLKRMLLSEDDCNLLP SWAFFIRCLVNADGLLSTASRESFVSNDSLKDARKEIGVAIKEYLRALVQNNRSVFNKILDVHHFHIKAI ASEDNELLRLFMDYLPFETNKGIRSFGSIRSSNNTIYYTRNLEDFRQVRRIAGAQGRLVVNAAYTFDETL LKKYIRLNQELSLEEISPARLLEEFAEVEGNKEHRSFETKASELLKRFGCICRLKHFTPVDTPVIFVAEE KEENSKVANNPLAAVLGSVNAKKRLPPTLTFNADNEMVQTLLRIQGDNKLFQHVVHILYVQSLLQGKYPV NSEEMELFNHSLSELMTAKMNDFINFLN

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGAAAAAGAAGGTAATAATCTGTTTCAGGTCAATCTTAAAGGTATGATTGCCCTGTTGTCAGAGCATATTTATAGTAATCCGAATAC
TTTTGTCCGGGAGTTATTGCAAAATAGTGTGGATGCCATCACTGCATTGCACAACATCGATGAAAATTACTCCGGACGTATTGATGTCTT
CCTGAATGGGGATGGCTCGATGGTCTTTCAGGACAATGGAATCGGACTGAAGGAAGAGGAGGTATACCGTTTCCTCACAGTGATAGGTGA
AAGTTCAAAGAGAGACACTCCCGATGCCGACGATTTTATCGGTCGGTTTGGTATCGGCTTGTTGTCTTGTTTTGTGGTGACCAATGAAAT
CAGGGTAGAGAGCCGGTCGGCAATGGGGGGAAATCCTGTTTGCTGGTGCGGAAAGGTGGACGGTACTTATCAGACTACTTTCCCCGATGA
AGAGTGGGAGATCGGTTCAAGGGTTGTGTTGAGGCCTAAAAATGAATGGGCTCATCTGTTCGAATACGAAGTGTTTAAAAAGATATTGGT
AAATTATGGAGAAGTCTTGCCATATCCTGTCTATTTACATGGTGGAGAAGAAGAAGAGTTGGTTAATACCCCATCGCCCGTCTGGCTTGA
TCCGAAAGCTACCCGGAAAGAGTTATTGGATTATGGGACAAAGGTCTTCCAATCGTCTGCCCTGGATGCATTTCCTATACGGACAGAGCA
TGGACGGATAGAAGGTGTACTCTATGTATTGCCTTTCCGTACGCAATTCTCTGTGCGTAATTCGCATAAAGTATATCTGAAGCGGATGTT
GCTTAGTGAGGACGATTGCAATCTGTTGCCTTCTTGGGCATTTTTTATTCGTTGCCTGGTGAATGCCGACGGACTGCTTTCCACAGCCTC
CCGCGAATCATTTGTCAGCAACGATTCATTGAAAGATGCCCGGAAAGAGATTGGGGTCGCTATCAAGGAATATCTCCGGGCTTTGGTGCA
GAACAATCGGTCCGTTTTTAATAAAATACTGGATGTTCATCACTTTCACATTAAAGCCATTGCTTCGGAAGATAATGAGTTACTTCGTCT
GTTTATGGATTATCTTCCGTTTGAGACGAATAAGGGAATAAGAAGTTTCGGTAGTATCCGTTCGTCAAATAATACTATTTATTATACACG
CAATCTGGAAGATTTCAGGCAAGTGCGCAGAATAGCCGGTGCACAAGGCAGGCTGGTAGTTAATGCTGCTTATACATTCGATGAAACGTT
GTTGAAAAAATATATCCGGCTTAATCAAGAATTGTCTTTAGAGGAGATTTCACCTGCCCGTCTGTTGGAAGAGTTTGCCGAAGTAGAGGG
TAATAAAGAGCACCGGTCTTTTGAAACGAAAGCCAGTGAACTTTTGAAACGTTTTGGGTGTATTTGCCGGTTGAAGCATTTCACTCCGGT
GGATACTCCGGTTATATTCGTAGCCGAAGAAAAAGAAGAGAACAGTAAAGTCGCCAATAATCCGTTGGCGGCGGTATTGGGCTCGGTAAA
TGCCAAAAAACGTTTGCCACCCACATTGACTTTCAATGCCGACAATGAGATGGTGCAGACATTGCTGAGAATCCAGGGAGACAACAAGTT
GTTTCAGCATGTTGTGCACATTCTGTATGTACAATCGCTTTTGCAAGGAAAATATCCCGTGAACAGTGAGGAGATGGAACTTTTCAATCA
CTCTCTTTCTGAATTGATGACTGCCAAAATGAATGATTTTATAAACTTTCTCAATTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine49128 %
Guanine44226 %
Thyamine51330 %
Cytosine32119 %
A+T100457 %
G+C76344 %

Total Bases :   1767 bases

Microsatellites
SequencePosition LengthRepeats
AGAGAG27723
AGAGAG36523
GGGGGG38323
AGAAGAAGAAGA58434
TTTTTT84923
AAAAAA126323
AAAAAA153323
CTCTCT170923

Microsatellite Map

ATGGAAAAAGAAGGTAATAATCTGTTTCAGGTCAATCTTAAAGGTATGATTGCCCTGTTGTCAGAGCATATTTATAGTAATCCGAATACT
TTTGTCCGGGAGTTATTGCAAAATAGTGTGGATGCCATCACTGCATTGCACAACATCGATGAAAATTACTCCGGACGTATTGATGTCTTC
CTGAATGGGGATGGCTCGATGGTCTTTCAGGACAATGGAATCGGACTGAAGGAAGAGGAGGTATACCGTTTCCTCACAGTGATAGGTGAA
AGTTCAAAGAGAGACACTCCCGATGCCGACGATTTTATCGGTCGGTTTGGTATCGGCTTGTTGTCTTGTTTTGTGGTGACCAATGAAATC
AGGGTAGAGAGCCGGTCGGCAATGGGGGGAAATCCTGTTTGCTGGTGCGGAAAGGTGGACGGTACTTATCAGACTACTTTCCCCGATGAA
GAGTGGGAGATCGGTTCAAGGGTTGTGTTGAGGCCTAAAAATGAATGGGCTCATCTGTTCGAATACGAAGTGTTTAAAAAGATATTGGTA
AATTATGGAGAAGTCTTGCCATATCCTGTCTATTTACATGGTGGAGAAGAAGAAGAGTTGGTTAATACCCCATCGCCCGTCTGGCTTGAT
CCGAAAGCTACCCGGAAAGAGTTATTGGATTATGGGACAAAGGTCTTCCAATCGTCTGCCCTGGATGCATTTCCTATACGGACAGAGCAT
GGACGGATAGAAGGTGTACTCTATGTATTGCCTTTCCGTACGCAATTCTCTGTGCGTAATTCGCATAAAGTATATCTGAAGCGGATGTTG
CTTAGTGAGGACGATTGCAATCTGTTGCCTTCTTGGGCATTTTTTATTCGTTGCCTGGTGAATGCCGACGGACTGCTTTCCACAGCCTCC
CGCGAATCATTTGTCAGCAACGATTCATTGAAAGATGCCCGGAAAGAGATTGGGGTCGCTATCAAGGAATATCTCCGGGCTTTGGTGCAG
AACAATCGGTCCGTTTTTAATAAAATACTGGATGTTCATCACTTTCACATTAAAGCCATTGCTTCGGAAGATAATGAGTTACTTCGTCTG
TTTATGGATTATCTTCCGTTTGAGACGAATAAGGGAATAAGAAGTTTCGGTAGTATCCGTTCGTCAAATAATACTATTTATTATACACGC
AATCTGGAAGATTTCAGGCAAGTGCGCAGAATAGCCGGTGCACAAGGCAGGCTGGTAGTTAATGCTGCTTATACATTCGATGAAACGTTG
TTGAAAAAATATATCCGGCTTAATCAAGAATTGTCTTTAGAGGAGATTTCACCTGCCCGTCTGTTGGAAGAGTTTGCCGAAGTAGAGGGT
AATAAAGAGCACCGGTCTTTTGAAACGAAAGCCAGTGAACTTTTGAAACGTTTTGGGTGTATTTGCCGGTTGAAGCATTTCACTCCGGTG
GATACTCCGGTTATATTCGTAGCCGAAGAAAAAGAAGAGAACAGTAAAGTCGCCAATAATCCGTTGGCGGCGGTATTGGGCTCGGTAAAT
GCCAAAAAACGTTTGCCACCCACATTGACTTTCAATGCCGACAATGAGATGGTGCAGACATTGCTGAGAATCCAGGGAGACAACAAGTTG
TTTCAGCATGTTGTGCACATTCTGTATGTACAATCGCTTTTGCAAGGAAAATATCCCGTGAACAGTGAGGAGATGGAACTTTTCAATCAC
TCTCTTTCTGAATTGATGACTGCCAAAATGAATGATTTTATAAACTTTCTCAATTAA

Gene Information
Molecule Type genomic DNA
Bases 1767 Bases
Molecular Weight548116.35 Da
Coding Sequence CR626927.1:212717..214483
NCBI ReferenceCAH05971
NotesSimilar to Leptospira interrogans heat shock protein

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 3 to 199 197 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 203 to 430 228 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 431 to 588 158 C-terminal Domain of HSP90 Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BAFR2

Accession Number

HSP90_0018

Added on

2012-02-02

Updated On

2014-01-20