Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Bacteroides fragilis str. NCTC 9343

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_BACFN, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

BF2491

Gene Identifier

3283262

Taxon Information

Organism

Bacteroides fragilis str. NCTC 9343

Organism ID

272559 [NCBI] [UNIPROT]

Lineage

Bacteria; Bacteroidetes; Bacteroidia; Bacteroidales; Bacteroidaceae;Bacteroides; Bacteroides fragilis NCTC 9343

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MQKGNIGVTTENIFPIIKKFLYSDHEIFLRELVSNAVDATQKLNTLASISEFKGELGDLTVHVSLGKDTI TISDRGIGLTAEEIDKYINQIAFSGANDFLEKYKNDANAIIGHFGLGFYSAFMVSKKVEIITKSYKEGAQ AVKWTCDGSPEFTLEEVEKADRGTDIVLYIDDDCKEFLEESRISALLKKYCSFLPVPIAFGKKKEWKDGK QVETAEDNVINDTIPLWTKKPSELSDEDYKKFYRELYPMSDEPLFWIHLNVDYPFHLTGILYFPKVKSNI DLNKNKIQLYCNQVYVTDSVEGIVPDFLTLLHGVLDSPDIPLNVSRSYLQSDSNVKKISTYISKKVSDRL QSIFKNDRAQFEEKWNDLKIFINYGMLTQEDFYDKAQKFALFTDTDGKHYTFEEYQTLIKDNQTDKDKNL IYLYANNKDEQFAYIEAAKNKGYNVLLMDGQLDVAMVSMLEQKLEKSRFTRVDSDVVDNLIVKEDKKSDV LEASKQEALSAAFKSQLPKMEKVEFNVMTQALGENGSPVMITQSEYMRRMKEMANIQAGMSFYGEMPDMF NLVLNSDHKLVKEVLADEEKECSAAIAPIQTELEDVTKRRDALKKKQEGKKDEDIPTAEKDELNDLDKKW DELKQQKDSIFAGYAGKNKVVRQLIDLALLQNNMLKGEALNNFVKRSIELI

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCAAAAAGGTAATATTGGGGTTACAACAGAGAACATTTTCCCTATCATCAAAAAGTTTTTGTACAGTGACCATGAAATCTTCCTGCG
GGAATTAGTATCCAATGCCGTTGATGCCACTCAGAAGTTGAATACATTGGCTTCTATCAGTGAATTTAAGGGCGAACTGGGTGATTTGAC
CGTTCACGTTTCATTAGGTAAAGACACCATTACCATCTCCGATCGTGGTATCGGTTTGACTGCTGAAGAGATTGATAAATATATCAACCA
GATTGCCTTTTCGGGGGCTAACGATTTCCTTGAAAAATATAAAAACGATGCGAATGCCATCATTGGACACTTCGGACTTGGGTTCTACTC
TGCATTCATGGTTTCCAAGAAGGTTGAAATTATCACCAAATCATATAAAGAAGGTGCACAGGCCGTAAAATGGACTTGCGACGGTAGTCC
GGAGTTTACACTTGAAGAGGTGGAGAAAGCGGATCGTGGTACAGATATCGTATTGTATATTGATGATGATTGCAAGGAGTTTCTCGAGGA
GTCACGCATCTCTGCCCTCCTGAAGAAATATTGCAGCTTCCTGCCCGTTCCCATCGCTTTTGGTAAAAAGAAAGAGTGGAAAGACGGCAA
ACAAGTAGAGACGGCGGAAGATAATGTCATCAATGACACCATTCCTTTGTGGACAAAGAAACCGAGTGAATTGTCGGACGAAGATTATAA
AAAATTCTATCGTGAGCTTTATCCGATGTCAGACGAACCTTTGTTCTGGATTCATTTGAATGTAGACTATCCGTTCCATCTGACCGGTAT
CCTCTACTTCCCGAAGGTAAAGAGCAATATTGATTTGAATAAGAATAAGATTCAGTTGTATTGTAATCAGGTTTATGTTACGGATTCTGT
AGAAGGTATTGTTCCGGATTTCCTTACTCTGCTCCATGGTGTGCTCGATTCACCGGATATTCCTTTGAATGTATCCCGTTCTTACCTGCA
AAGTGATTCGAACGTGAAGAAGATCTCTACCTATATTTCGAAAAAGGTATCAGACCGTCTGCAATCTATCTTTAAGAATGATCGCGCTCA
GTTCGAAGAGAAGTGGAATGATTTAAAAATCTTTATTAATTATGGAATGCTCACTCAAGAGGATTTCTATGATAAAGCACAAAAATTCGC
CCTTTTCACCGATACGGATGGCAAACATTACACCTTTGAGGAGTACCAGACTTTGATTAAAGATAATCAGACAGATAAAGATAAAAACCT
GATCTATCTGTATGCCAATAATAAGGACGAACAGTTTGCCTATATCGAAGCTGCCAAAAATAAAGGTTACAATGTGCTGTTGATGGACGG
GCAACTGGATGTGGCCATGGTAAGTATGCTCGAACAGAAACTGGAGAAATCTCGCTTCACCCGTGTAGACAGTGATGTTGTCGACAACCT
GATTGTGAAAGAAGATAAGAAGAGCGATGTGCTTGAGGCTTCAAAACAAGAAGCTCTGTCAGCAGCCTTCAAGAGTCAGTTGCCGAAAAT
GGAAAAGGTTGAATTTAATGTCATGACTCAGGCTTTAGGCGAAAACGGCTCTCCCGTGATGATAACCCAGAGCGAATATATGCGCCGTAT
GAAGGAAATGGCCAATATTCAGGCTGGCATGAGTTTCTATGGTGAAATGCCCGATATGTTTAATCTGGTATTGAATTCAGACCATAAATT
GGTGAAAGAAGTATTGGCTGATGAAGAAAAAGAGTGCAGTGCTGCCATTGCTCCTATACAGACGGAACTGGAAGATGTGACAAAACGTCG
TGATGCACTCAAGAAAAAGCAAGAAGGCAAGAAAGACGAAGATATCCCTACTGCGGAGAAAGATGAACTCAATGATCTGGATAAGAAATG
GGATGAGTTGAAGCAGCAGAAAGATTCTATTTTTGCCGGATATGCAGGCAAAAACAAAGTGGTACGTCAGTTGATCGATCTAGCGTTGTT
GCAAAACAATATGCTGAAAGGTGAAGCATTAAATAACTTTGTAAAAAGAAGCATTGAGCTGATTTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine65833 %
Guanine47023 %
Thyamine55428 %
Cytosine36418 %
A+T121260 %
G+C83441 %

Total Bases :   2046 bases

Microsatellites
SequencePosition LengthRepeats
ATATAT25723
TGATGATGA50933
AAAAAA71723
ATATAT160423

Microsatellite Map

ATGCAAAAAGGTAATATTGGGGTTACAACAGAGAACATTTTCCCTATCATCAAAAAGTTTTTGTACAGTGACCATGAAATCTTCCTGCGG
GAATTAGTATCCAATGCCGTTGATGCCACTCAGAAGTTGAATACATTGGCTTCTATCAGTGAATTTAAGGGCGAACTGGGTGATTTGACC
GTTCACGTTTCATTAGGTAAAGACACCATTACCATCTCCGATCGTGGTATCGGTTTGACTGCTGAAGAGATTGATAAATATATCAACCAG
ATTGCCTTTTCGGGGGCTAACGATTTCCTTGAAAAATATAAAAACGATGCGAATGCCATCATTGGACACTTCGGACTTGGGTTCTACTCT
GCATTCATGGTTTCCAAGAAGGTTGAAATTATCACCAAATCATATAAAGAAGGTGCACAGGCCGTAAAATGGACTTGCGACGGTAGTCCG
GAGTTTACACTTGAAGAGGTGGAGAAAGCGGATCGTGGTACAGATATCGTATTGTATATTGATGATGATTGCAAGGAGTTTCTCGAGGAG
TCACGCATCTCTGCCCTCCTGAAGAAATATTGCAGCTTCCTGCCCGTTCCCATCGCTTTTGGTAAAAAGAAAGAGTGGAAAGACGGCAAA
CAAGTAGAGACGGCGGAAGATAATGTCATCAATGACACCATTCCTTTGTGGACAAAGAAACCGAGTGAATTGTCGGACGAAGATTATAAA
AAATTCTATCGTGAGCTTTATCCGATGTCAGACGAACCTTTGTTCTGGATTCATTTGAATGTAGACTATCCGTTCCATCTGACCGGTATC
CTCTACTTCCCGAAGGTAAAGAGCAATATTGATTTGAATAAGAATAAGATTCAGTTGTATTGTAATCAGGTTTATGTTACGGATTCTGTA
GAAGGTATTGTTCCGGATTTCCTTACTCTGCTCCATGGTGTGCTCGATTCACCGGATATTCCTTTGAATGTATCCCGTTCTTACCTGCAA
AGTGATTCGAACGTGAAGAAGATCTCTACCTATATTTCGAAAAAGGTATCAGACCGTCTGCAATCTATCTTTAAGAATGATCGCGCTCAG
TTCGAAGAGAAGTGGAATGATTTAAAAATCTTTATTAATTATGGAATGCTCACTCAAGAGGATTTCTATGATAAAGCACAAAAATTCGCC
CTTTTCACCGATACGGATGGCAAACATTACACCTTTGAGGAGTACCAGACTTTGATTAAAGATAATCAGACAGATAAAGATAAAAACCTG
ATCTATCTGTATGCCAATAATAAGGACGAACAGTTTGCCTATATCGAAGCTGCCAAAAATAAAGGTTACAATGTGCTGTTGATGGACGGG
CAACTGGATGTGGCCATGGTAAGTATGCTCGAACAGAAACTGGAGAAATCTCGCTTCACCCGTGTAGACAGTGATGTTGTCGACAACCTG
ATTGTGAAAGAAGATAAGAAGAGCGATGTGCTTGAGGCTTCAAAACAAGAAGCTCTGTCAGCAGCCTTCAAGAGTCAGTTGCCGAAAATG
GAAAAGGTTGAATTTAATGTCATGACTCAGGCTTTAGGCGAAAACGGCTCTCCCGTGATGATAACCCAGAGCGAATATATGCGCCGTATG
AAGGAAATGGCCAATATTCAGGCTGGCATGAGTTTCTATGGTGAAATGCCCGATATGTTTAATCTGGTATTGAATTCAGACCATAAATTG
GTGAAAGAAGTATTGGCTGATGAAGAAAAAGAGTGCAGTGCTGCCATTGCTCCTATACAGACGGAACTGGAAGATGTGACAAAACGTCGT
GATGCACTCAAGAAAAAGCAAGAAGGCAAGAAAGACGAAGATATCCCTACTGCGGAGAAAGATGAACTCAATGATCTGGATAAGAAATGG
GATGAGTTGAAGCAGCAGAAAGATTCTATTTTTGCCGGATATGCAGGCAAAAACAAAGTGGTACGTCAGTTGATCGATCTAGCGTTGTTG
CAAAACAATATGCTGAAAGGTGAAGCATTAAATAACTTTGTAAAAAGAAGCATTGAGCTGATTTAA

Gene Information
Molecule Type genomic DNA
Bases 2046 Bases
Molecular Weight634547.24 Da
Coding Sequence complement(CR626927.1:2894220..2896265)
NCBI ReferenceCAH08191
NotesAlmost identical to previously sequenced Bacteroides

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 1 to 207 207 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 222 to 475 254 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 476 to 681 206 C-terminal Domain of HSP90 Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BAFR1

Accession Number

HSP90_0017

Added on

2012-02-02

Updated On

2014-01-20