Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Bacillus subtilis subsp. subtilis str. 168

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_BACSU, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

BSU39820

Gene Identifier

937631

Taxon Information

Organism

Bacillus subtilis subsp. subtilis str. 168

Organism ID

224308 [NCBI] [UNIPROT]

Lineage

Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus; Bacillus subtilis subsp. subtilis str. 168

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MAKKEFKAESKRLLDMMINSIYTQKEIFLRELISNSSDAIDKIYYKALTDDALTFDKDSYYIKVAADKDA RTLTISDTGIGMTKDELEQHLGTIAKSGSLAFKKENELKDGHDIIGQFGVGFYAAFMVADVVTVISKALG SEEAYKWESAGADGYTIEPCEKDSVGTDIILKIKENTEDDSYDEFLEEYRLKAIIKKYSDFIRYPIKMDT TINKPKEGSENEFEEVQEEQTVNSMVPIWRKNKSELTDEDYEKFYAEKHYGFDKPLTHVHISVDGAVRYN AILFVPENMPFDYYSKEYEKGLELYSNGVLIMNKCADLLPDHFSFVKGMVDSEDLSLNISREMLQHDRQL KLIAKNISKKIKSELQSLLKKDREKYETFYKSFGRQLKFGVYNDFGANKDQLKDLLLFYSSKEKKLVSLD EYVSRMPEEQKFIYYATGDSYDRIEKLPQTEMVADKGYEILYFTEDIDEFAIKMLASYQEKEFKSVSSGD LGIDTDEDQKQSEEEESKYKDLFEEMKNILSDKVKNVRISKRLKSHPVCLAADGEVTIEMEKILNAMPDS QNVKAEKVLEINPNHEVFQTLQDAFEQDKEKLSLYTNLLYNQALLIEGLPIQDPVEFTNNICKVMV

FASTA Format Composition Secondary Structure

Nucleotide
 GTGGCGAAAAAAGAGTTTAAAGCAGAGTCTAAACGCTTGCTGGATATGATGATTAACTCCATTTATACCCAAAAAGAAATTTTCCTGCG
CGAGTTAATCTCCAATTCGAGTGATGCGATTGACAAAATCTATTACAAAGCGCTTACGGACGATGCGCTTACGTTTGATAAAGACAGTTA
CTACATAAAGGTCGCAGCTGACAAAGATGCGAGAACATTAACCATCTCTGATACGGGGATCGGAATGACAAAGGATGAGCTTGAACAGCA
TCTTGGAACAATTGCAAAAAGCGGTTCCCTCGCGTTTAAAAAGGAAAACGAGCTGAAAGACGGACATGACATTATCGGGCAGTTCGGTGT
CGGTTTTTACGCGGCATTTATGGTTGCCGATGTCGTGACAGTCATCAGTAAAGCGCTTGGCAGCGAAGAGGCTTATAAATGGGAGTCTGC
GGGTGCAGACGGCTATACGATTGAGCCGTGTGAAAAGGATTCTGTCGGTACAGACATTATCCTGAAAATCAAAGAGAACACAGAAGATGA
CAGCTATGACGAGTTTTTAGAGGAATATCGTTTAAAAGCGATCATCAAGAAGTACTCCGACTTCATTCGCTACCCGATCAAAATGGATAC
AACCATTAATAAGCCGAAGGAAGGCAGCGAAAATGAATTTGAAGAGGTGCAGGAAGAGCAGACGGTCAACAGCATGGTGCCGATCTGGAG
AAAAAACAAAAGCGAGCTGACAGATGAGGATTATGAAAAATTCTATGCTGAAAAGCATTACGGGTTTGATAAACCGCTGACACACGTTCA
TATCAGCGTGGATGGAGCGGTTCGCTACAACGCGATTCTATTCGTCCCTGAAAACATGCCGTTTGACTACTATTCCAAGGAATATGAGAA
AGGCTTGGAGCTGTATTCCAATGGCGTGCTGATCATGAATAAGTGCGCAGACCTGCTACCGGACCACTTCAGCTTTGTGAAGGGCATGGT
CGATTCTGAGGATCTGTCGCTGAATATTTCCAGAGAAATGCTGCAGCATGACCGCCAGCTGAAGCTGATCGCGAAAAACATCAGCAAGAA
AATCAAAAGCGAGCTGCAAAGCCTGTTGAAAAAAGACCGCGAGAAATACGAGACGTTCTACAAGTCGTTCGGCAGACAGCTGAAATTCGG
CGTGTACAATGATTTTGGCGCGAATAAGGATCAATTGAAGGATCTCCTCTTATTCTACTCTTCAAAAGAGAAAAAACTGGTCAGCTTAGA
CGAGTATGTTTCCAGAATGCCAGAGGAGCAGAAATTCATTTATTACGCGACCGGTGATTCTTACGACCGCATTGAGAAACTGCCGCAAAC
GGAAATGGTGGCGGACAAAGGCTATGAAATCCTCTACTTTACTGAGGACATCGATGAGTTTGCAATTAAAATGCTGGCTTCTTATCAGGA
AAAAGAATTCAAGTCCGTATCAAGCGGAGACCTTGGCATAGACACGGATGAGGATCAAAAGCAGTCCGAGGAAGAGGAAAGCAAGTATAA
GGATCTGTTTGAGGAAATGAAAAACATTCTGTCAGACAAAGTGAAAAACGTCAGAATCTCAAAACGGCTTAAATCACATCCAGTCTGCCT
TGCTGCTGACGGCGAAGTGACAATTGAGATGGAAAAAATCTTAAATGCGATGCCTGACAGCCAAAATGTGAAGGCGGAAAAAGTGCTGGA
AATCAACCCAAATCACGAGGTATTCCAAACACTGCAGGACGCGTTTGAACAAGATAAAGAGAAGCTGAGCCTGTACACAAACCTTCTGTA
CAATCAGGCGCTCCTCATCGAAGGCCTGCCGATTCAGGACCCTGTGGAATTTACGAACAATATTTGCAAGGTCATGGTGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine62534 %
Guanine46325 %
Thyamine42423 %
Cytosine36920 %
A+T104956 %
G+C83245 %

Total Bases :   1881 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA623
AAAAAA71923
ACACAC79823
AAAAAA110723
AAAAAA123923
AAAAAA165123

Microsatellite Map

GTGGCGAAAAAAGAGTTTAAAGCAGAGTCTAAACGCTTGCTGGATATGATGATTAACTCCATTTATACCCAAAAAGAAATTTTCCTGCGC
GAGTTAATCTCCAATTCGAGTGATGCGATTGACAAAATCTATTACAAAGCGCTTACGGACGATGCGCTTACGTTTGATAAAGACAGTTAC
TACATAAAGGTCGCAGCTGACAAAGATGCGAGAACATTAACCATCTCTGATACGGGGATCGGAATGACAAAGGATGAGCTTGAACAGCAT
CTTGGAACAATTGCAAAAAGCGGTTCCCTCGCGTTTAAAAAGGAAAACGAGCTGAAAGACGGACATGACATTATCGGGCAGTTCGGTGTC
GGTTTTTACGCGGCATTTATGGTTGCCGATGTCGTGACAGTCATCAGTAAAGCGCTTGGCAGCGAAGAGGCTTATAAATGGGAGTCTGCG
GGTGCAGACGGCTATACGATTGAGCCGTGTGAAAAGGATTCTGTCGGTACAGACATTATCCTGAAAATCAAAGAGAACACAGAAGATGAC
AGCTATGACGAGTTTTTAGAGGAATATCGTTTAAAAGCGATCATCAAGAAGTACTCCGACTTCATTCGCTACCCGATCAAAATGGATACA
ACCATTAATAAGCCGAAGGAAGGCAGCGAAAATGAATTTGAAGAGGTGCAGGAAGAGCAGACGGTCAACAGCATGGTGCCGATCTGGAGA
AAAAACAAAAGCGAGCTGACAGATGAGGATTATGAAAAATTCTATGCTGAAAAGCATTACGGGTTTGATAAACCGCTGACACACGTTCAT
ATCAGCGTGGATGGAGCGGTTCGCTACAACGCGATTCTATTCGTCCCTGAAAACATGCCGTTTGACTACTATTCCAAGGAATATGAGAAA
GGCTTGGAGCTGTATTCCAATGGCGTGCTGATCATGAATAAGTGCGCAGACCTGCTACCGGACCACTTCAGCTTTGTGAAGGGCATGGTC
GATTCTGAGGATCTGTCGCTGAATATTTCCAGAGAAATGCTGCAGCATGACCGCCAGCTGAAGCTGATCGCGAAAAACATCAGCAAGAAA
ATCAAAAGCGAGCTGCAAAGCCTGTTGAAAAAAGACCGCGAGAAATACGAGACGTTCTACAAGTCGTTCGGCAGACAGCTGAAATTCGGC
GTGTACAATGATTTTGGCGCGAATAAGGATCAATTGAAGGATCTCCTCTTATTCTACTCTTCAAAAGAGAAAAAACTGGTCAGCTTAGAC
GAGTATGTTTCCAGAATGCCAGAGGAGCAGAAATTCATTTATTACGCGACCGGTGATTCTTACGACCGCATTGAGAAACTGCCGCAAACG
GAAATGGTGGCGGACAAAGGCTATGAAATCCTCTACTTTACTGAGGACATCGATGAGTTTGCAATTAAAATGCTGGCTTCTTATCAGGAA
AAAGAATTCAAGTCCGTATCAAGCGGAGACCTTGGCATAGACACGGATGAGGATCAAAAGCAGTCCGAGGAAGAGGAAAGCAAGTATAAG
GATCTGTTTGAGGAAATGAAAAACATTCTGTCAGACAAAGTGAAAAACGTCAGAATCTCAAAACGGCTTAAATCACATCCAGTCTGCCTT
GCTGCTGACGGCGAAGTGACAATTGAGATGGAAAAAATCTTAAATGCGATGCCTGACAGCCAAAATGTGAAGGCGGAAAAAGTGCTGGAA
ATCAACCCAAATCACGAGGTATTCCAAACACTGCAGGACGCGTTTGAACAAGATAAAGAGAAGCTGAGCCTGTACACAAACCTTCTGTAC
AATCAGGCGCTCCTCATCGAAGGCCTGCCGATTCAGGACCCTGTGGAATTTACGAACAATATTTGCAAGGTCATGGTGTAA

Gene Information
Molecule Type genomic DNA
Bases 1881 Bases
Molecular Weight583806.74 Da
Coding Sequence AB005554.1:27770..29650
NCBI ReferenceBAA21603
Notesconserved universally; induced by heat shock

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 1 to 215 215 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 234 to 489 256 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 511 to 625 115 C-terminal Domain of HSP90 SSF110942
coiled coil 496 to 523 28 Coiled Coil Region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BASU1

Accession Number

HSP90_0016

Added on

2012-02-02

Updated On

2014-01-20