Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Bacillus licheniformis str. ATCC 14580

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_BACLD, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

BL00247

Gene Identifier

3030682

Taxon Information

Organism

Bacillus licheniformis str. ATCC 14580

Organism ID

279010 [NCBI] [UNIPROT]

Lineage

Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus; Bacillus licheniformis ATcoiled coil 14580

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MAKREFKAESKRLLDIMINSIYSQKEVFLRELISNASDAIDKIYYKALTDDSLTFNKDDYYIKISADKEN RTLTIADTGIGMTKEELEEHLGTIAKSGSLAFKQENELKDGHDIIGQFGVGFYAAFMVADTVTVITKAHG SDEAHQWESAGADGYTIEPAAKESAGTDVILKLKENTDDENYDEYLDVHRLKAIIKTYSDFIRYPIKMDV AVNKPKEGAENEFEEVQEEQTVNSMVPIWRKNKSELKDEDYEAFYKEKHYGFDKPLAHIHTSVDGAVRYH AILFIPENIPFNYYTKEFEKGLELYSNGVLIMEKCPDLLPDHFSFVKGMVDSEDLSLNISREMLQHDRQL KLIAKNISKKIKNELKSLLKNDREKYESFYQSFGRQLKFGVYNDFGAHKDLLKDLLLFYSSKEKKLVTLE EYVSRMPEDQKYIYYASGDSYDRIEKLPQTELVSEKGYEILYFTEDIDEFAIKMLANYQEKEFKSVSSGD LGIENDDEQNQSDGDDSQYKDLFEEMKKTLDGKVKSVRASKRLKTHSVCLAADGEVTIEMEKILNAMPDN QHVKADKVLEINTNHEVFKTLQNAFDNDKDKFKLYTGLLYNQALLIEGLPIEDPVEFTNDICKVMA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCTAAGAGAGAATTCAAAGCAGAATCCAAGCGATTGCTGGACATCATGATCAACTCGATTTATTCCCAAAAGGAAGTCTTTTTAAG
GGAGCTGATATCCAATGCGAGCGATGCCATCGATAAAATCTACTACAAAGCGCTGACAGATGATTCACTGACATTTAACAAAGACGATTA
CTACATAAAAATCTCCGCAGATAAAGAAAACAGAACGCTGACCATTGCGGACACCGGAATCGGCATGACGAAAGAAGAGCTTGAAGAGCA
TCTTGGAACGATTGCCAAGAGCGGCTCGCTTGCGTTTAAACAAGAAAACGAATTAAAAGACGGGCACGATATTATCGGCCAGTTCGGCGT
CGGTTTCTACGCCGCTTTTATGGTTGCGGACACCGTCACCGTCATTACAAAAGCCCATGGCAGCGATGAAGCGCATCAATGGGAATCAGC
CGGAGCCGACGGCTATACAATCGAACCGGCTGCGAAAGAATCAGCCGGAACCGATGTCATTCTGAAGCTGAAAGAGAATACAGACGATGA
AAACTATGATGAATACCTGGATGTTCATCGCTTAAAAGCGATCATCAAAACATACTCTGATTTCATCCGCTACCCGATCAAGATGGATGT
CGCGGTCAACAAGCCGAAAGAAGGCGCCGAAAATGAATTTGAAGAAGTCCAGGAAGAACAGACGGTCAACAGCATGGTGCCGATTTGGAG
AAAAAACAAAAGCGAACTGAAAGATGAAGATTATGAGGCGTTTTATAAGGAAAAGCATTACGGTTTTGACAAGCCTCTCGCGCACATCCA
TACAAGCGTAGACGGCGCGGTGAGATACCATGCGATTTTATTCATTCCTGAAAATATTCCGTTCAACTACTACACGAAGGAATTCGAGAA
GGGTCTGGAACTGTATTCGAACGGTGTGCTGATCATGGAAAAGTGTCCGGATCTGCTGCCTGACCATTTCAGCTTTGTCAAAGGAATGGT
TGATTCAGAAGATTTATCGCTCAACATTTCGAGGGAGATGCTCCAGCATGACAGGCAGCTGAAGCTGATTGCCAAAAACATCAGCAAAAA
AATCAAGAATGAGCTGAAGAGCTTGCTGAAAAATGACAGAGAAAAATACGAGTCTTTTTATCAATCGTTTGGCAGACAGCTTAAATTCGG
GGTATACAATGATTTTGGAGCCCATAAAGATCTGTTGAAAGACCTGCTGCTTTTCTATTCATCAAAAGAGAAAAAGCTGGTCACCCTTGA
GGAATATGTGTCCAGAATGCCTGAAGATCAAAAATACATTTATTATGCATCAGGCGACTCGTATGACCGAATAGAAAAGCTTCCTCAAAC
CGAGCTGGTTTCGGAAAAAGGGTATGAAATCCTTTATTTCACCGAGGATATCGATGAGTTCGCCATCAAAATGCTGGCGAATTATCAAGA
GAAAGAATTCAAGTCGGTATCAAGCGGCGACCTCGGAATCGAAAACGATGACGAGCAAAACCAATCTGACGGGGATGACAGCCAATACAA
AGACCTGTTTGAAGAGATGAAAAAGACTCTGGATGGAAAAGTGAAAAGCGTGAGGGCGTCAAAACGGCTGAAGACTCACTCCGTATGCCT
TGCCGCTGACGGAGAAGTCACCATCGAGATGGAGAAAATCTTAAACGCAATGCCTGACAATCAGCATGTAAAGGCTGATAAAGTATTGGA
AATCAATACAAACCACGAAGTCTTCAAAACATTGCAGAATGCTTTTGACAACGACAAGGATAAATTCAAACTGTACACCGGCCTCCTGTA
CAACCAGGCGCTGCTGATAGAAGGCTTGCCAATTGAAGACCCCGTCGAATTTACGAACGATATATGCAAAGTAATGGCATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine64635 %
Guanine43824 %
Thyamine41122 %
Cytosine38621 %
A+T105757 %
G+C82444 %

Total Bases :   1881 bases

Microsatellites
SequencePosition LengthRepeats
AGAGAG723
AAAAAA71923
AAAAAA107423
ATATAT185823

Microsatellite Map

ATGGCTAAGAGAGAATTCAAAGCAGAATCCAAGCGATTGCTGGACATCATGATCAACTCGATTTATTCCCAAAAGGAAGTCTTTTTAAGG
GAGCTGATATCCAATGCGAGCGATGCCATCGATAAAATCTACTACAAAGCGCTGACAGATGATTCACTGACATTTAACAAAGACGATTAC
TACATAAAAATCTCCGCAGATAAAGAAAACAGAACGCTGACCATTGCGGACACCGGAATCGGCATGACGAAAGAAGAGCTTGAAGAGCAT
CTTGGAACGATTGCCAAGAGCGGCTCGCTTGCGTTTAAACAAGAAAACGAATTAAAAGACGGGCACGATATTATCGGCCAGTTCGGCGTC
GGTTTCTACGCCGCTTTTATGGTTGCGGACACCGTCACCGTCATTACAAAAGCCCATGGCAGCGATGAAGCGCATCAATGGGAATCAGCC
GGAGCCGACGGCTATACAATCGAACCGGCTGCGAAAGAATCAGCCGGAACCGATGTCATTCTGAAGCTGAAAGAGAATACAGACGATGAA
AACTATGATGAATACCTGGATGTTCATCGCTTAAAAGCGATCATCAAAACATACTCTGATTTCATCCGCTACCCGATCAAGATGGATGTC
GCGGTCAACAAGCCGAAAGAAGGCGCCGAAAATGAATTTGAAGAAGTCCAGGAAGAACAGACGGTCAACAGCATGGTGCCGATTTGGAGA
AAAAACAAAAGCGAACTGAAAGATGAAGATTATGAGGCGTTTTATAAGGAAAAGCATTACGGTTTTGACAAGCCTCTCGCGCACATCCAT
ACAAGCGTAGACGGCGCGGTGAGATACCATGCGATTTTATTCATTCCTGAAAATATTCCGTTCAACTACTACACGAAGGAATTCGAGAAG
GGTCTGGAACTGTATTCGAACGGTGTGCTGATCATGGAAAAGTGTCCGGATCTGCTGCCTGACCATTTCAGCTTTGTCAAAGGAATGGTT
GATTCAGAAGATTTATCGCTCAACATTTCGAGGGAGATGCTCCAGCATGACAGGCAGCTGAAGCTGATTGCCAAAAACATCAGCAAAAAA
ATCAAGAATGAGCTGAAGAGCTTGCTGAAAAATGACAGAGAAAAATACGAGTCTTTTTATCAATCGTTTGGCAGACAGCTTAAATTCGGG
GTATACAATGATTTTGGAGCCCATAAAGATCTGTTGAAAGACCTGCTGCTTTTCTATTCATCAAAAGAGAAAAAGCTGGTCACCCTTGAG
GAATATGTGTCCAGAATGCCTGAAGATCAAAAATACATTTATTATGCATCAGGCGACTCGTATGACCGAATAGAAAAGCTTCCTCAAACC
GAGCTGGTTTCGGAAAAAGGGTATGAAATCCTTTATTTCACCGAGGATATCGATGAGTTCGCCATCAAAATGCTGGCGAATTATCAAGAG
AAAGAATTCAAGTCGGTATCAAGCGGCGACCTCGGAATCGAAAACGATGACGAGCAAAACCAATCTGACGGGGATGACAGCCAATACAAA
GACCTGTTTGAAGAGATGAAAAAGACTCTGGATGGAAAAGTGAAAAGCGTGAGGGCGTCAAAACGGCTGAAGACTCACTCCGTATGCCTT
GCCGCTGACGGAGAAGTCACCATCGAGATGGAGAAAATCTTAAACGCAATGCCTGACAATCAGCATGTAAAGGCTGATAAAGTATTGGAA
ATCAATACAAACCACGAAGTCTTCAAAACATTGCAGAATGCTTTTGACAACGACAAGGATAAATTCAAACTGTACACCGGCCTCCTGTAC
AACCAGGCGCTGCTGATAGAAGGCTTGCCAATTGAAGACCCCGTCGAATTTACGAACGATATATGCAAAGTAATGGCATAA

Gene Information
Molecule Type genomic DNA
Bases 1881 Bases
Molecular Weight583115.36 Da
Coding Sequence complement(AE017333.1:4095742..4097622)
NCBI ReferenceAAU43069
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 1 to 215 215 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 234 to 489 256 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 511 to 625 115 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BALI1

Accession Number

HSP90_0015

Added on

2012-02-02

Updated On

2014-01-20