Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Bacillus halodurans str. C-125

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_BACHD, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

BH1007

Gene Identifier

891720

Taxon Information

Organism

Bacillus halodurans str. C-125

Organism ID

272558 [NCBI] [UNIPROT]

Lineage

Bacteria;Firmicutes; Bacillales; Bacillaceae; Bacillus; Bacillus halodurans C-125

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MERKEFKAESKRLLEMMVNSIYSQKEIFLRELISNASDAIDKIYYRALSDDSITFNKDDYFIKVTANKED RTLTVSDTGIGMTKEELESNLGTIAKSGSLAFKTENESKDGHDIIGQFGVGFYSAFMVADKVTVTTKALG EESGYQWESTGADGYTILPIAKESVGTEIRLKLKENSEDESYDEFLEEYRLTSIIKKYSDFIRYPIKMDV TKRELKEGTEDEYEDVIEEQTINSMVPIWRKNKNELKDEDYTNFYHEKRYGFDQPLKHIHISVDGAVRYN AILFIPENIPFDYYTKEFEKGLELYSNGVLIMEKCPDLLPDYYSFVKGMVDSEDLSLNISREMLQHDRQL KLIAKNIKNKITSHLKTLLKDEREKFEQFYRSFGRQLKYGVYSDFGANKEDLQDLLLFYSSTEKKMVTLD EYVSRMKEDQPYIYYATGESYARIEKLPQTEMVADKGYEILYFTEDVDEFAIKMLASYKEKEFRSVSSGD LGFEDDEQKDTAADTDEQKELFEHMKTILDGKVKDVRASKRLKSHPVCLTAEGEVSIEMEKVLRAMPDNQ NVQAEKVLEINVNHDVFDVLKASFESDKDKVDLYTKLLYNQALLIEGLPVEDPVAFSNDICKVMA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGAGAGAAAAGAGTTTAAAGCGGAATCGAAACGGCTGTTAGAAATGATGGTTAACTCCATTTACTCGCAAAAGGAAATTTTCTTGCG
AGAGCTCATTTCAAATGCGAGTGATGCGATTGATAAAATTTACTACAGAGCATTAAGCGATGATTCGATCACGTTTAACAAGGATGATTA
TTTTATTAAAGTAACGGCTAACAAAGAGGATCGGACGTTAACGGTAAGTGATACGGGAATTGGGATGACGAAAGAGGAGCTTGAAAGCAA
CCTCGGAACGATTGCTAAAAGTGGGTCGCTTGCCTTTAAAACCGAGAACGAAAGTAAAGACGGACATGACATTATTGGTCAGTTTGGGGT
TGGCTTTTACTCAGCATTTATGGTCGCAGATAAGGTTACCGTTACAACGAAAGCATTAGGAGAGGAAAGCGGCTATCAGTGGGAATCTAC
CGGTGCGGATGGTTATACGATTCTACCGATTGCTAAAGAGTCAGTCGGAACAGAGATTAGGTTAAAGCTCAAGGAAAATTCGGAGGATGA
ATCGTACGATGAGTTCCTAGAAGAGTACCGACTTACGAGCATTATTAAGAAGTATTCTGACTTCATCCGCTATCCGATCAAAATGGATGT
AACGAAGCGTGAGCTTAAGGAAGGTACCGAGGACGAATATGAGGACGTCATTGAGGAACAAACGATTAACAGCATGGTGCCAATTTGGCG
GAAAAATAAAAACGAGCTTAAAGACGAGGACTACACTAACTTTTATCATGAAAAACGGTACGGCTTTGACCAACCGTTAAAGCATATCCA
TATTAGCGTTGATGGGGCTGTTCGATATAACGCGATTCTTTTCATTCCAGAAAACATTCCATTTGATTATTACACGAAAGAATTTGAAAA
GGGCCTCGAGCTTTATTCGAACGGTGTGCTCATTATGGAGAAATGCCCTGACCTCCTTCCAGATTATTATAGCTTTGTGAAAGGAATGGT
CGACTCTGAGGATCTATCGCTCAACATTTCACGTGAAATGCTTCAGCACGACCGGCAGTTAAAGTTAATTGCGAAAAATATTAAAAACAA
GATTACGAGCCATTTAAAGACGTTATTAAAGGACGAACGGGAGAAATTCGAGCAATTCTACCGTTCATTTGGTCGCCAATTAAAATATGG
GGTGTACAGTGATTTTGGTGCCAATAAAGAGGACTTACAAGATTTGCTCCTTTTCTACTCTTCGACGGAGAAGAAAATGGTCACTTTAGA
CGAATATGTGTCTCGCATGAAAGAAGACCAGCCGTACATTTACTATGCGACAGGGGAATCCTATGCTCGGATTGAGAAATTGCCGCAAAC
GGAAATGGTCGCAGATAAGGGATATGAAATTTTATATTTCACAGAAGATGTGGATGAGTTTGCGATTAAAATGTTAGCTAGCTATAAAGA
AAAAGAATTCCGTTCTGTCTCAAGTGGTGACTTAGGATTCGAAGATGACGAGCAGAAGGATACTGCCGCTGACACGGACGAACAGAAAGA
GCTGTTTGAACATATGAAAACCATTTTAGACGGCAAAGTGAAAGATGTTCGAGCCTCCAAACGATTGAAATCCCATCCTGTGTGCCTTAC
TGCAGAGGGGGAAGTATCAATTGAAATGGAGAAGGTACTCCGAGCGATGCCTGATAATCAAAACGTTCAAGCAGAAAAAGTGTTAGAAAT
CAATGTGAACCATGACGTGTTCGATGTATTGAAGGCATCATTTGAGTCAGATAAAGATAAAGTCGATTTATATACGAAGCTTTTGTACAA
TCAGGCACTACTCATTGAAGGATTACCAGTGGAAGATCCGGTCGCCTTCTCAAATGATATTTGCAAGGTGATGGCATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine62734 %
Guanine45225 %
Thyamine48326 %
Cytosine31617 %
A+T111060 %
G+C76841 %

Total Bases :   1878 bases

Microsatellites
SequencePosition LengthRepeats
GAGAGA323
TGTGTG160723
TATATA177723

Microsatellite Map

ATGGAGAGAAAAGAGTTTAAAGCGGAATCGAAACGGCTGTTAGAAATGATGGTTAACTCCATTTACTCGCAAAAGGAAATTTTCTTGCGA
GAGCTCATTTCAAATGCGAGTGATGCGATTGATAAAATTTACTACAGAGCATTAAGCGATGATTCGATCACGTTTAACAAGGATGATTAT
TTTATTAAAGTAACGGCTAACAAAGAGGATCGGACGTTAACGGTAAGTGATACGGGAATTGGGATGACGAAAGAGGAGCTTGAAAGCAAC
CTCGGAACGATTGCTAAAAGTGGGTCGCTTGCCTTTAAAACCGAGAACGAAAGTAAAGACGGACATGACATTATTGGTCAGTTTGGGGTT
GGCTTTTACTCAGCATTTATGGTCGCAGATAAGGTTACCGTTACAACGAAAGCATTAGGAGAGGAAAGCGGCTATCAGTGGGAATCTACC
GGTGCGGATGGTTATACGATTCTACCGATTGCTAAAGAGTCAGTCGGAACAGAGATTAGGTTAAAGCTCAAGGAAAATTCGGAGGATGAA
TCGTACGATGAGTTCCTAGAAGAGTACCGACTTACGAGCATTATTAAGAAGTATTCTGACTTCATCCGCTATCCGATCAAAATGGATGTA
ACGAAGCGTGAGCTTAAGGAAGGTACCGAGGACGAATATGAGGACGTCATTGAGGAACAAACGATTAACAGCATGGTGCCAATTTGGCGG
AAAAATAAAAACGAGCTTAAAGACGAGGACTACACTAACTTTTATCATGAAAAACGGTACGGCTTTGACCAACCGTTAAAGCATATCCAT
ATTAGCGTTGATGGGGCTGTTCGATATAACGCGATTCTTTTCATTCCAGAAAACATTCCATTTGATTATTACACGAAAGAATTTGAAAAG
GGCCTCGAGCTTTATTCGAACGGTGTGCTCATTATGGAGAAATGCCCTGACCTCCTTCCAGATTATTATAGCTTTGTGAAAGGAATGGTC
GACTCTGAGGATCTATCGCTCAACATTTCACGTGAAATGCTTCAGCACGACCGGCAGTTAAAGTTAATTGCGAAAAATATTAAAAACAAG
ATTACGAGCCATTTAAAGACGTTATTAAAGGACGAACGGGAGAAATTCGAGCAATTCTACCGTTCATTTGGTCGCCAATTAAAATATGGG
GTGTACAGTGATTTTGGTGCCAATAAAGAGGACTTACAAGATTTGCTCCTTTTCTACTCTTCGACGGAGAAGAAAATGGTCACTTTAGAC
GAATATGTGTCTCGCATGAAAGAAGACCAGCCGTACATTTACTATGCGACAGGGGAATCCTATGCTCGGATTGAGAAATTGCCGCAAACG
GAAATGGTCGCAGATAAGGGATATGAAATTTTATATTTCACAGAAGATGTGGATGAGTTTGCGATTAAAATGTTAGCTAGCTATAAAGAA
AAAGAATTCCGTTCTGTCTCAAGTGGTGACTTAGGATTCGAAGATGACGAGCAGAAGGATACTGCCGCTGACACGGACGAACAGAAAGAG
CTGTTTGAACATATGAAAACCATTTTAGACGGCAAAGTGAAAGATGTTCGAGCCTCCAAACGATTGAAATCCCATCCTGTGTGCCTTACT
GCAGAGGGGGAAGTATCAATTGAAATGGAGAAGGTACTCCGAGCGATGCCTGATAATCAAAACGTTCAAGCAGAAAAAGTGTTAGAAATC
AATGTGAACCATGACGTGTTCGATGTATTGAAGGCATCATTTGAGTCAGATAAAGATAAAGTCGATTTATATACGAAGCTTTTGTACAAT
CAGGCACTACTCATTGAAGGATTACCAGTGGAAGATCCGGTCGCCTTCTCAAATGATATTTGCAAGGTGATGGCATAA

Gene Information
Molecule Type genomic DNA
Bases 1878 Bases
Molecular Weight583433.11 Da
Coding Sequence BA000004.3:1085167..1087044
NCBI ReferenceBAB04726
NotesBH1007

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 1 to 215 215 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 234 to 489 256 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 510 to 624 116 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BAHA1

Accession Number

HSP90_0014

Added on

2012-02-02

Updated On

2014-01-20