Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Bacillus amyloliquefaciens str. FZB42

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_BACA2, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

RBAM_036820

Gene Identifier

5459863

Taxon Information

Organism

Bacillus amyloliquefaciens str. FZB42

Organism ID

326423 [NCBI] [UNIPROT]

Lineage

Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus; Bacillus amyloliquefaciens FZB42

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MRKKKFKAESKRLLDMMINSIYTQKEIFLRELISNASDAIDKIYYKALTDDSLTFDQDNYYIKVTADKEA RTLTVTDTGIGMTKDELEQHLGTIAKSGSLAFKQENDSKDGHDIIGQFGVGFYAAFMVADKVTVKSKALG SDEAYVWESEGAAGYTIAPCDKETIGTEITLKIKENTEDESYDEFLENYRIKAIVKKYSDFIRYPIKMEE TVNKPKEGSENEFEEVQEEQTVNSMVPIWRKNKSELTDEDYEAFYAEKHYGFDKPLTHVHISVDGAVRYN SILFIPENMPFDYYTKEFEKGLELYSNGVLIMNKCADLLPDHFSFVKGMVDSEDLSLNISREMLQHDRQL KLIAKNINKKIKAELKSLLKNKREKYESFYESFGRQLKFGVYNDFGANKDVLKDLLLFYSSKEKKLVTLD EYVSRMPEDQKYIYYASGDSYERIEKLPQTEMVADKGYEILYFTEDIDEFAIKMLTSYEEKEFKSVSSAD LGIDSDEDEKQTEAEENEYKDLFESMKEILADKVKNVRASKRLKSHPVCFATDGEVTIEMEKVLNAMPDS QQVKAEKVLEINPNHEVFETLKNAHGQDREKLALYTNLLYNQALLIEGLPIHDPVEFTNDICKVMV

FASTA Format Composition Secondary Structure

Nucleotide
 GTGCGGAAAAAAAAGTTTAAAGCAGAATCCAAGCGATTGCTGGACATGATGATTAACTCCATTTACACGCAGAAGGAAATTTTTCTCCG
CGAGTTAATTTCCAACGCGAGCGATGCGATTGACAAAATCTATTACAAGGCGTTAACCGATGATTCATTAACGTTTGATCAAGACAATTA
CTACATAAAAGTGACGGCGGACAAAGAAGCGAGAACGCTCACCGTCACAGACACCGGTATCGGGATGACAAAAGACGAGCTTGAACAGCA
TCTCGGCACAATTGCGAAAAGCGGTTCACTCGCTTTCAAGCAAGAAAATGACTCGAAAGACGGCCATGACATTATCGGCCAGTTCGGCGT
CGGATTTTATGCGGCGTTTATGGTGGCTGATAAAGTCACGGTGAAAAGTAAGGCGCTCGGCAGTGACGAGGCGTATGTATGGGAGTCGGA
AGGGGCTGCCGGCTACACGATCGCGCCGTGTGACAAGGAAACCATCGGTACGGAAATCACCTTGAAAATAAAAGAAAACACAGAAGATGA
AAGCTATGATGAGTTTTTAGAAAACTACCGCATCAAAGCGATCGTGAAAAAGTACTCTGATTTTATCCGCTACCCGATCAAAATGGAAGA
GACGGTCAACAAGCCGAAAGAGGGCAGCGAGAACGAATTTGAAGAAGTTCAGGAAGAACAGACGGTCAACAGCATGGTGCCGATCTGGAG
AAAAAACAAAAGCGAGCTGACGGATGAGGATTACGAGGCTTTTTACGCCGAGAAGCATTACGGTTTTGATAAACCGCTGACCCATGTGCA
TATCAGCGTCGATGGAGCGGTGCGCTACAATTCGATTTTGTTTATTCCGGAAAACATGCCGTTTGACTATTATACGAAGGAATTCGAAAA
AGGATTGGAGCTGTACTCCAACGGCGTGCTGATCATGAACAAATGCGCCGACCTGCTTCCGGACCATTTCAGCTTTGTAAAAGGCATGGT
GGATTCTGAGGATCTGTCGCTGAACATTTCCAGAGAGATGCTGCAGCACGACCGCCAGCTGAAGCTGATTGCGAAAAACATCAATAAAAA
AATCAAAGCCGAGCTCAAGAGCCTGCTGAAGAACAAAAGGGAAAAATACGAATCTTTCTATGAATCTTTCGGCAGACAGCTGAAATTCGG
CGTCTATAATGATTTCGGCGCGAATAAAGACGTATTAAAAGATCTGCTTCTCTTCTATTCATCTAAGGAGAAAAAGCTCGTCACTCTGGA
CGAATATGTGTCCAGAATGCCTGAGGATCAAAAATATATCTATTACGCGTCCGGCGATTCATATGAGCGGATTGAAAAGCTGCCGCAAAC
TGAAATGGTCGCGGACAAAGGCTACGAAATTTTATATTTCACGGAGGATATTGATGAATTCGCGATCAAAATGCTGACAAGCTACGAGGA
AAAAGAATTCAAGTCCGTATCCAGCGCCGACTTAGGCATCGACAGTGATGAGGATGAAAAGCAGACCGAAGCCGAAGAAAACGAATATAA
AGACCTGTTCGAAAGCATGAAAGAGATTCTTGCGGATAAAGTAAAGAACGTCAGAGCATCGAAACGTTTAAAATCCCATCCGGTATGCTT
TGCGACAGACGGCGAAGTGACGATCGAAATGGAGAAAGTGTTAAACGCCATGCCTGACAGCCAGCAGGTCAAAGCGGAAAAAGTGCTGGA
AATCAACCCGAATCACGAAGTGTTTGAGACGTTAAAGAACGCGCACGGACAAGATCGGGAAAAGCTGGCATTATACACAAATCTTCTCTA
CAATCAGGCGCTTCTGATTGAAGGGCTGCCGATCCATGATCCGGTCGAATTTACGAATGACATTTGCAAAGTTATGGTATGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine62834 %
Guanine46925 %
Thyamine40522 %
Cytosine37921 %
A+T103355 %
G+C84846 %

Total Bases :   1881 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAAAA624
AAAAAA71923
AGAGAG102023
AAAAAA107423
ATATAT129223

Microsatellite Map

GTGCGGAAAAAAAAGTTTAAAGCAGAATCCAAGCGATTGCTGGACATGATGATTAACTCCATTTACACGCAGAAGGAAATTTTTCTCCGC
GAGTTAATTTCCAACGCGAGCGATGCGATTGACAAAATCTATTACAAGGCGTTAACCGATGATTCATTAACGTTTGATCAAGACAATTAC
TACATAAAAGTGACGGCGGACAAAGAAGCGAGAACGCTCACCGTCACAGACACCGGTATCGGGATGACAAAAGACGAGCTTGAACAGCAT
CTCGGCACAATTGCGAAAAGCGGTTCACTCGCTTTCAAGCAAGAAAATGACTCGAAAGACGGCCATGACATTATCGGCCAGTTCGGCGTC
GGATTTTATGCGGCGTTTATGGTGGCTGATAAAGTCACGGTGAAAAGTAAGGCGCTCGGCAGTGACGAGGCGTATGTATGGGAGTCGGAA
GGGGCTGCCGGCTACACGATCGCGCCGTGTGACAAGGAAACCATCGGTACGGAAATCACCTTGAAAATAAAAGAAAACACAGAAGATGAA
AGCTATGATGAGTTTTTAGAAAACTACCGCATCAAAGCGATCGTGAAAAAGTACTCTGATTTTATCCGCTACCCGATCAAAATGGAAGAG
ACGGTCAACAAGCCGAAAGAGGGCAGCGAGAACGAATTTGAAGAAGTTCAGGAAGAACAGACGGTCAACAGCATGGTGCCGATCTGGAGA
AAAAACAAAAGCGAGCTGACGGATGAGGATTACGAGGCTTTTTACGCCGAGAAGCATTACGGTTTTGATAAACCGCTGACCCATGTGCAT
ATCAGCGTCGATGGAGCGGTGCGCTACAATTCGATTTTGTTTATTCCGGAAAACATGCCGTTTGACTATTATACGAAGGAATTCGAAAAA
GGATTGGAGCTGTACTCCAACGGCGTGCTGATCATGAACAAATGCGCCGACCTGCTTCCGGACCATTTCAGCTTTGTAAAAGGCATGGTG
GATTCTGAGGATCTGTCGCTGAACATTTCCAGAGAGATGCTGCAGCACGACCGCCAGCTGAAGCTGATTGCGAAAAACATCAATAAAAAA
ATCAAAGCCGAGCTCAAGAGCCTGCTGAAGAACAAAAGGGAAAAATACGAATCTTTCTATGAATCTTTCGGCAGACAGCTGAAATTCGGC
GTCTATAATGATTTCGGCGCGAATAAAGACGTATTAAAAGATCTGCTTCTCTTCTATTCATCTAAGGAGAAAAAGCTCGTCACTCTGGAC
GAATATGTGTCCAGAATGCCTGAGGATCAAAAATATATCTATTACGCGTCCGGCGATTCATATGAGCGGATTGAAAAGCTGCCGCAAACT
GAAATGGTCGCGGACAAAGGCTACGAAATTTTATATTTCACGGAGGATATTGATGAATTCGCGATCAAAATGCTGACAAGCTACGAGGAA
AAAGAATTCAAGTCCGTATCCAGCGCCGACTTAGGCATCGACAGTGATGAGGATGAAAAGCAGACCGAAGCCGAAGAAAACGAATATAAA
GACCTGTTCGAAAGCATGAAAGAGATTCTTGCGGATAAAGTAAAGAACGTCAGAGCATCGAAACGTTTAAAATCCCATCCGGTATGCTTT
GCGACAGACGGCGAAGTGACGATCGAAATGGAGAAAGTGTTAAACGCCATGCCTGACAGCCAGCAGGTCAAAGCGGAAAAAGTGCTGGAA
ATCAACCCGAATCACGAAGTGTTTGAGACGTTAAAGAACGCGCACGGACAAGATCGGGAAAAGCTGGCATTATACACAAATCTTCTCTAC
AATCAGGCGCTTCTGATTGAAGGGCTGCCGATCCATGATCCGGTCGAATTTACGAATGACATTTGCAAAGTTATGGTATGA

Gene Information
Molecule Type genomic DNA
Bases 1881 Bases
Molecular Weight583833.63 Da
Coding Sequence complement(CP000560.1:3789867..3791747)
NCBI ReferenceABS76011
Notesclass III heat-shock protein (molecular chaperone)

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 1 to 215 215 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 234 to 489 256 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 511 to 625 116 C-terminal Domain of HSP90 SSF110942
coiled coil 496 to 523 28 Coiled Coil Region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_BAAM1

Accession Number

HSP90_0013

Added on

2012-02-02

Updated On

2014-01-20