Help  Custom Search
 
Heat shock protein HtpG of Azotobacter vinelandii str. DJ

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein HtpG

Synonymous Names

C1DEE4_AZOVD, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

Avin_19170

Gene Identifier

7760852

Taxon Information

Organism

Azotobacter vinelandii str. DJ

Organism ID

322710 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Azotobacter; Azotobacter vinelandii DJ

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MSVDTQKETLGFQAEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFEALSRPELLEDDAELKIRI SFDKEARTVTLEDNGIGMSREDAILHLGTIAKSGTADFLKSLSGDQKKDSHLIGQFGVGFYSAFIVAEKV EVFSRRAGLPASEGVHWASQGEGDFEVSSIEKPERGTRIVLHLKEGEEEFADGWRLRNIVRKYSDHIALP IELPKEHFSDDKEDRSASIEWETVNRASALWTRPRSEIKDNEYQEFYKHIAHDFQDALTWTHNKVEGKLE YTSLLYVPSHAPFDLYHRDAPKGLKLYVQRVFIMDQADEFLPLYLRFVKGVVDSNDLSLNVSREILQKAP VIDSMKFVLTKRVLDVLEKLAKSEPEKYKTFWGAFGQVLKEGPAEDFANRERIAGLLRFASTRDESGEQS VALADYVERMREGQDKIYYLTGESHIQIENSPHLEIFRKKGIEVLLLTDRIDEWLMGYLTDFSGKQFVDV ARGDLNLGKLDTDEDRQAQNEAAKAKEGLIERLKSVLDDQVTEVRVSHRLTESPAILALGEQDLGLQMRQ ILEASGQKVPEAKPIFEINPAHPLILKLDTEVDEDRFKDFALVIFDQAVLAAGNGLKNPADYVQRLNRLL VELSA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGTGTGGATACTCAAAAAGAAACGCTGGGCTTCCAGGCCGAGGTGAAGCAGTTGCTTCATCTGATGATTCATTCGCTCTATTCCAA
CAAGGAAATCTTTCTCCGCGAGTTGATTTCCAATGCTTCCGATGCGGCCGACAAATTGCGTTTCGAGGCCCTGTCCAGGCCTGAGCTGCT
TGAGGATGATGCGGAGCTGAAAATTCGCATCAGCTTTGACAAGGAGGCCAGGACCGTTACGCTTGAGGACAATGGCATCGGCATGAGCCG
AGAAGACGCAATCCTCCATCTGGGAACCATCGCCAAATCCGGGACTGCTGATTTCCTGAAGAGCCTCTCGGGTGATCAGAAAAAAGACTC
CCATCTGATCGGGCAGTTTGGTGTGGGGTTCTATTCTGCTTTTATCGTCGCCGAAAAGGTCGAGGTATTCAGTCGTCGGGCCGGACTGCC
GGCCAGCGAAGGGGTGCATTGGGCATCGCAGGGCGAGGGTGATTTCGAGGTCTCGTCGATCGAGAAGCCCGAGAGGGGTACCAGAATCGT
CCTGCACTTGAAGGAGGGGGAGGAGGAGTTCGCCGATGGATGGCGCTTGCGCAATATTGTAAGGAAGTACTCCGATCATATCGCTTTGCC
CATTGAATTGCCAAAAGAGCATTTCAGTGATGATAAAGAGGATCGCTCGGCCTCAATCGAGTGGGAAACCGTAAATCGCGCCAGCGCCTT
GTGGACTCGGCCTCGTAGCGAAATAAAGGACAATGAGTATCAAGAGTTCTACAAGCATATCGCTCATGACTTTCAGGATGCTCTGACCTG
GACCCACAACAAGGTCGAAGGCAAGCTGGAGTACACCTCACTGCTTTATGTACCGAGCCACGCCCCCTTCGATCTCTATCACCGCGATGC
ACCTAAAGGGTTGAAGCTTTATGTGCAACGTGTATTCATCATGGATCAGGCTGATGAGTTTCTCCCTTTGTACTTGCGCTTCGTCAAGGG
GGTAGTGGATTCCAATGATCTATCATTGAACGTATCCCGTGAAATCCTGCAGAAGGCCCCCGTCATCGACTCGATGAAGTTCGTGCTGAC
AAAGCGTGTGCTGGATGTGCTGGAAAAACTGGCTAAGAGCGAGCCGGAAAAATACAAGACTTTCTGGGGGGCTTTCGGTCAGGTACTCAA
GGAGGGGCCGGCGGAGGACTTCGCTAACAGAGAGCGTATCGCGGGCCTTCTACGATTCGCTTCTACGAGGGATGAGTCCGGCGAACAGAG
TGTTGCCCTGGCGGATTACGTGGAGCGGATGCGTGAAGGACAGGATAAAATCTATTACCTCACAGGCGAAAGCCATATCCAGATAGAAAA
CAGTCCCCATCTTGAAATTTTCCGCAAGAAGGGGATTGAGGTACTGCTGTTGACTGATCGCATTGATGAGTGGTTGATGGGGTACCTTAC
TGATTTTAGTGGCAAGCAATTTGTGGATGTTGCTCGCGGTGATCTCAACCTTGGCAAGTTGGACACAGATGAAGACAGGCAGGCTCAGAA
TGAAGCCGCCAAGGCCAAGGAAGGGCTGATCGAGCGCTTGAAGTCAGTACTGGACGATCAAGTGACCGAGGTACGGGTGTCGCATCGCTT
GACCGAGTCGCCGGCGATTCTGGCTCTTGGCGAGCAGGACCTTGGCTTGCAGATGCGTCAGATTCTCGAGGCTAGTGGACAAAAGGTTCC
GGAAGCGAAGCCGATTTTCGAGATCAACCCCGCGCATCCGCTGATTTTGAAGCTGGACACCGAGGTCGATGAGGACCGCTTCAAGGACTT
CGCGCTGGTCATTTTCGATCAGGCCGTACTGGCGGCGGGTAATGGCTTGAAGAATCCCGCTGATTATGTGCAGCGCCTGAATCGGTTGCT
GGTGGAGTTATCTGCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine45724 %
Guanine56530 %
Thyamine44224 %
Cytosine44424 %
A+T89948 %
G+C100953 %

Total Bases :   1908 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA34823
GGAGGAGGA55733
GGGGGG114423
AGAGAG119723

Microsatellite Map

ATGAGTGTGGATACTCAAAAAGAAACGCTGGGCTTCCAGGCCGAGGTGAAGCAGTTGCTTCATCTGATGATTCATTCGCTCTATTCCAAC
AAGGAAATCTTTCTCCGCGAGTTGATTTCCAATGCTTCCGATGCGGCCGACAAATTGCGTTTCGAGGCCCTGTCCAGGCCTGAGCTGCTT
GAGGATGATGCGGAGCTGAAAATTCGCATCAGCTTTGACAAGGAGGCCAGGACCGTTACGCTTGAGGACAATGGCATCGGCATGAGCCGA
GAAGACGCAATCCTCCATCTGGGAACCATCGCCAAATCCGGGACTGCTGATTTCCTGAAGAGCCTCTCGGGTGATCAGAAAAAAGACTCC
CATCTGATCGGGCAGTTTGGTGTGGGGTTCTATTCTGCTTTTATCGTCGCCGAAAAGGTCGAGGTATTCAGTCGTCGGGCCGGACTGCCG
GCCAGCGAAGGGGTGCATTGGGCATCGCAGGGCGAGGGTGATTTCGAGGTCTCGTCGATCGAGAAGCCCGAGAGGGGTACCAGAATCGTC
CTGCACTTGAAGGAGGGGGAGGAGGAGTTCGCCGATGGATGGCGCTTGCGCAATATTGTAAGGAAGTACTCCGATCATATCGCTTTGCCC
ATTGAATTGCCAAAAGAGCATTTCAGTGATGATAAAGAGGATCGCTCGGCCTCAATCGAGTGGGAAACCGTAAATCGCGCCAGCGCCTTG
TGGACTCGGCCTCGTAGCGAAATAAAGGACAATGAGTATCAAGAGTTCTACAAGCATATCGCTCATGACTTTCAGGATGCTCTGACCTGG
ACCCACAACAAGGTCGAAGGCAAGCTGGAGTACACCTCACTGCTTTATGTACCGAGCCACGCCCCCTTCGATCTCTATCACCGCGATGCA
CCTAAAGGGTTGAAGCTTTATGTGCAACGTGTATTCATCATGGATCAGGCTGATGAGTTTCTCCCTTTGTACTTGCGCTTCGTCAAGGGG
GTAGTGGATTCCAATGATCTATCATTGAACGTATCCCGTGAAATCCTGCAGAAGGCCCCCGTCATCGACTCGATGAAGTTCGTGCTGACA
AAGCGTGTGCTGGATGTGCTGGAAAAACTGGCTAAGAGCGAGCCGGAAAAATACAAGACTTTCTGGGGGGCTTTCGGTCAGGTACTCAAG
GAGGGGCCGGCGGAGGACTTCGCTAACAGAGAGCGTATCGCGGGCCTTCTACGATTCGCTTCTACGAGGGATGAGTCCGGCGAACAGAGT
GTTGCCCTGGCGGATTACGTGGAGCGGATGCGTGAAGGACAGGATAAAATCTATTACCTCACAGGCGAAAGCCATATCCAGATAGAAAAC
AGTCCCCATCTTGAAATTTTCCGCAAGAAGGGGATTGAGGTACTGCTGTTGACTGATCGCATTGATGAGTGGTTGATGGGGTACCTTACT
GATTTTAGTGGCAAGCAATTTGTGGATGTTGCTCGCGGTGATCTCAACCTTGGCAAGTTGGACACAGATGAAGACAGGCAGGCTCAGAAT
GAAGCCGCCAAGGCCAAGGAAGGGCTGATCGAGCGCTTGAAGTCAGTACTGGACGATCAAGTGACCGAGGTACGGGTGTCGCATCGCTTG
ACCGAGTCGCCGGCGATTCTGGCTCTTGGCGAGCAGGACCTTGGCTTGCAGATGCGTCAGATTCTCGAGGCTAGTGGACAAAAGGTTCCG
GAAGCGAAGCCGATTTTCGAGATCAACCCCGCGCATCCGCTGATTTTGAAGCTGGACACCGAGGTCGATGAGGACCGCTTCAAGGACTTC
GCGCTGGTCATTTTCGATCAGGCCGTACTGGCGGCGGGTAATGGCTTGAAGAATCCCGCTGATTATGTGCAGCGCCTGAATCGGTTGCTG
GTGGAGTTATCTGCCTGA

Gene Information
Molecule Type genomic DNA
Bases 1908 Bases
Molecular Weight591930.98 Da
Coding Sequence CP001157.1:1906850..1908757
NCBI ReferenceACO78129
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 6 to 220 215 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 236 to 493 258 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 518 to 632 115 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_AZVI1

Accession Number

HSP90_0012

Added on

2012-02-02

Updated On

2014-01-20