Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Azorhizobium caulinodans str. ORS 571

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_AZOC5, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

AZC_4352

Gene Identifier

5691168

Taxon Information

Organism

Azorhizobium caulinodans str. ORS 571

Organism ID

438753 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Azorhizobium; Azorhizobium caulinodans ORS 571

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MTTAEAAAPESRTFEADVAKLLHLMVHSVYSDKDVFLRELISNAADACEKLRYEAITTPALLGEDARPRI TLAIDAEGGRLTVEDNGIGMSRDEMVEALGTIARSGTKAFMERIEAAAGGEKAELIGQFGVGFYSAFMVA EKVDVISRRAGADTANIWSSDGKGAYTVGEIDVAQAPARGTRVVLHLNEDGKAYADRFRIERIVKEQSGH VPVPIYIVEKLDAEPEEIADGVALWTKSKSDISAEDYADFYRSVAGQFDQPALTVHFRAEGRHEYTALVF VPSTKPFDLFEPERTGRVKLYVKRVFITDDAELLPRYLRFVRGVVDSADLPLNLSREMLQDSAILAAIRK GVTGRVLTELEKLAQSDAEAYAGIWSNFGAVLKEGLYEDYERRAQLLNLARFKTTTSGTAADTGWRTLKD YVADLKENQTAIYYITGDLARVEHAPQLEGFRARGVEVLLLPDQVDSFWVTAGVDYEGKPFKSVTQGAAD LSLIPLPKSDEAETPEPEAKDTGDFIAFVKETLGDQVADVRASDRLTTSAVCLVAPESGIDRRLEKLLAS AGRLGDAAKPVLEINPRHPLVAALAAHGASDSNFRADAAHLLLDQARVLDGDQPSDPQAFAERLMRVMQR GLPTA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGACGACCGCCGAAGCCGCCGCCCCCGAAAGCCGCACCTTCGAGGCCGATGTCGCCAAGCTCCTGCATCTGATGGTGCACTCGGTCTA
TTCCGACAAGGACGTGTTCCTGCGCGAGCTGATCTCAAACGCCGCCGATGCGTGCGAGAAGCTGCGTTACGAGGCCATCACCACTCCGGC
CCTACTGGGCGAGGACGCCCGCCCGCGCATCACGCTGGCTATCGATGCCGAGGGCGGCCGCCTGACCGTGGAAGACAATGGCATTGGCAT
GAGCCGCGACGAGATGGTCGAGGCGCTCGGCACCATCGCCCGCTCCGGCACCAAGGCCTTCATGGAGCGCATTGAGGCGGCCGCCGGCGG
CGAGAAGGCCGAACTCATCGGCCAGTTCGGCGTCGGCTTCTATTCCGCCTTCATGGTCGCGGAGAAGGTGGATGTCATTTCCCGGCGCGC
CGGTGCCGATACGGCCAACATCTGGTCTTCTGATGGCAAGGGCGCCTATACGGTCGGCGAGATCGACGTGGCGCAGGCGCCCGCCCGCGG
CACCCGCGTTGTGCTGCACCTCAATGAGGACGGCAAGGCCTATGCCGACCGCTTCCGCATCGAGCGCATCGTCAAGGAGCAGTCCGGCCA
CGTGCCGGTGCCGATCTATATCGTCGAGAAGCTGGACGCCGAGCCCGAGGAGATCGCCGATGGCGTCGCCCTCTGGACCAAGTCGAAGAG
CGACATTTCGGCCGAGGACTATGCGGATTTCTACCGCTCCGTCGCCGGCCAGTTCGACCAGCCAGCGCTGACGGTCCATTTCCGCGCCGA
GGGCCGGCACGAATACACCGCCCTCGTCTTCGTGCCCTCCACCAAGCCGTTCGACCTGTTCGAGCCCGAGCGCACCGGCCGGGTGAAGCT
CTATGTGAAGCGCGTCTTCATCACCGACGACGCGGAGCTTCTCCCCCGCTACCTGCGCTTCGTGCGCGGCGTCGTGGACAGCGCCGACCT
GCCGCTGAATCTGTCGCGCGAGATGCTGCAGGACAGCGCCATCCTCGCCGCCATCCGCAAGGGCGTGACCGGGCGCGTGCTGACCGAGCT
GGAGAAGCTAGCCCAGAGCGATGCCGAGGCCTATGCGGGCATCTGGTCCAATTTCGGCGCGGTGCTGAAGGAAGGCCTGTACGAGGATTA
CGAGCGGCGCGCCCAGCTCCTGAACCTCGCGCGATTCAAGACCACCACCAGCGGCACGGCGGCCGATACCGGCTGGCGCACGCTCAAGGA
CTATGTGGCGGACCTGAAGGAGAACCAGACCGCCATCTATTACATCACCGGCGACCTCGCCCGCGTGGAACATGCCCCGCAGTTGGAAGG
CTTCCGCGCCCGTGGCGTGGAGGTGCTGCTGCTGCCCGATCAGGTGGACAGCTTCTGGGTGACGGCGGGCGTCGATTATGAGGGCAAGCC
CTTCAAATCGGTGACGCAGGGCGCCGCCGACCTCTCCCTCATCCCGCTGCCGAAGTCGGATGAGGCGGAGACGCCGGAGCCTGAGGCGAA
GGATACGGGCGACTTCATCGCCTTCGTGAAGGAGACGCTGGGCGATCAGGTGGCGGATGTGCGTGCCTCGGACCGCCTCACCACCTCCGC
CGTCTGCCTCGTGGCGCCGGAGAGCGGCATCGACCGGCGGCTGGAGAAGCTGCTGGCGAGTGCCGGCCGGCTCGGCGATGCGGCCAAGCC
CGTGCTGGAGATCAATCCGCGCCATCCGCTGGTGGCGGCGCTGGCGGCGCATGGGGCCTCGGACAGCAACTTCCGCGCCGATGCCGCCCA
CCTCCTGCTCGATCAGGCCCGCGTGCTCGATGGCGACCAGCCCTCCGACCCGCAGGCCTTCGCCGAGCGCCTCATGCGGGTAATGCAGCG
CGGCCTGCCGACCGCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine32117 %
Guanine62933 %
Thyamine30216 %
Cytosine65635 %
A+T62333 %
G+C128568 %

Total Bases :   1908 bases

Microsatellites
SequencePosition LengthRepeats
GCCGCCGCC1533
GCGCGC44323
CGCGCG100323
GCGCGC117523
CGCGCG119623
ACCACCACC120933
TGCTGCTGCTGC137234

Microsatellite Map

ATGACGACCGCCGAAGCCGCCGCCCCCGAAAGCCGCACCTTCGAGGCCGATGTCGCCAAGCTCCTGCATCTGATGGTGCACTCGGTCTAT
TCCGACAAGGACGTGTTCCTGCGCGAGCTGATCTCAAACGCCGCCGATGCGTGCGAGAAGCTGCGTTACGAGGCCATCACCACTCCGGCC
CTACTGGGCGAGGACGCCCGCCCGCGCATCACGCTGGCTATCGATGCCGAGGGCGGCCGCCTGACCGTGGAAGACAATGGCATTGGCATG
AGCCGCGACGAGATGGTCGAGGCGCTCGGCACCATCGCCCGCTCCGGCACCAAGGCCTTCATGGAGCGCATTGAGGCGGCCGCCGGCGGC
GAGAAGGCCGAACTCATCGGCCAGTTCGGCGTCGGCTTCTATTCCGCCTTCATGGTCGCGGAGAAGGTGGATGTCATTTCCCGGCGCGCC
GGTGCCGATACGGCCAACATCTGGTCTTCTGATGGCAAGGGCGCCTATACGGTCGGCGAGATCGACGTGGCGCAGGCGCCCGCCCGCGGC
ACCCGCGTTGTGCTGCACCTCAATGAGGACGGCAAGGCCTATGCCGACCGCTTCCGCATCGAGCGCATCGTCAAGGAGCAGTCCGGCCAC
GTGCCGGTGCCGATCTATATCGTCGAGAAGCTGGACGCCGAGCCCGAGGAGATCGCCGATGGCGTCGCCCTCTGGACCAAGTCGAAGAGC
GACATTTCGGCCGAGGACTATGCGGATTTCTACCGCTCCGTCGCCGGCCAGTTCGACCAGCCAGCGCTGACGGTCCATTTCCGCGCCGAG
GGCCGGCACGAATACACCGCCCTCGTCTTCGTGCCCTCCACCAAGCCGTTCGACCTGTTCGAGCCCGAGCGCACCGGCCGGGTGAAGCTC
TATGTGAAGCGCGTCTTCATCACCGACGACGCGGAGCTTCTCCCCCGCTACCTGCGCTTCGTGCGCGGCGTCGTGGACAGCGCCGACCTG
CCGCTGAATCTGTCGCGCGAGATGCTGCAGGACAGCGCCATCCTCGCCGCCATCCGCAAGGGCGTGACCGGGCGCGTGCTGACCGAGCTG
GAGAAGCTAGCCCAGAGCGATGCCGAGGCCTATGCGGGCATCTGGTCCAATTTCGGCGCGGTGCTGAAGGAAGGCCTGTACGAGGATTAC
GAGCGGCGCGCCCAGCTCCTGAACCTCGCGCGATTCAAGACCACCACCAGCGGCACGGCGGCCGATACCGGCTGGCGCACGCTCAAGGAC
TATGTGGCGGACCTGAAGGAGAACCAGACCGCCATCTATTACATCACCGGCGACCTCGCCCGCGTGGAACATGCCCCGCAGTTGGAAGGC
TTCCGCGCCCGTGGCGTGGAGGTGCTGCTGCTGCCCGATCAGGTGGACAGCTTCTGGGTGACGGCGGGCGTCGATTATGAGGGCAAGCCC
TTCAAATCGGTGACGCAGGGCGCCGCCGACCTCTCCCTCATCCCGCTGCCGAAGTCGGATGAGGCGGAGACGCCGGAGCCTGAGGCGAAG
GATACGGGCGACTTCATCGCCTTCGTGAAGGAGACGCTGGGCGATCAGGTGGCGGATGTGCGTGCCTCGGACCGCCTCACCACCTCCGCC
GTCTGCCTCGTGGCGCCGGAGAGCGGCATCGACCGGCGGCTGGAGAAGCTGCTGGCGAGTGCCGGCCGGCTCGGCGATGCGGCCAAGCCC
GTGCTGGAGATCAATCCGCGCCATCCGCTGGTGGCGGCGCTGGCGGCGCATGGGGCCTCGGACAGCAACTTCCGCGCCGATGCCGCCCAC
CTCCTGCTCGATCAGGCCCGCGTGCTCGATGGCGACCAGCCCTCCGACCCGCAGGCCTTCGCCGAGCGCCTCATGCGGGTAATGCAGCGC
GGCCTGCCGACCGCCTGA

Gene Information
Molecule Type genomic DNA
Bases 1908 Bases
Molecular Weight589122.02 Da
Coding Sequence complement(AP009384.1:4944088..4945995)
NCBI ReferenceBAF90350
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 8 to 224 217 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 230 to 487 258 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 514 to 630 117 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_AZCA1

Accession Number

HSP90_0011

Added on

2012-02-02

Updated On

2014-01-20