Help  Custom Search
 
Heat shock protein Hsp90. of Anabaena variabilis str. ATCC 29413

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein Hsp90.

Synonymous Names

Q3MGW9_ANAVT, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Taxon Information

Organism

Anabaena variabilis str. ATCC 29413

Organism ID

240292 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena; Anabaena variabilis ATCC 29413

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MLEQGTISIHTENIFPIIKKSLYSDHQIFLRELVSNAVDAIQKLKMVSRAGEYAGVVEEPEIQLAIDKDK KTLSITDNGIGMTAEEVKKYINQVAFSSAEEFIHKYEGKSDQPIIGHFGLGFYSSFMVAQKVEIDTLSYQ EGAQAVHWSCDGSPAFTLEESPRTTRGTTITLTLLPDEEEYLESARVKNLVKTYCDFMPVPIKLDGEVLN KQKAPWRESANNLTKEDYLEFYRYLYPFQEEPLLWVHLNTDYPFIINGILYFPKMRPDVDVTKGQIKLFC NQVFVSDNCEEIIPQFLVPMRGVIDSTDIPLNVSRSALQGDRTVRKIGDYIAKKVGDRLKELYRDDREQY ISAWKDLSTFVKFGVLNDEKFKKQVEDIVIFRTTFKSAPPAETPAVEVQSQEGDVWQDVTPTSDSPTPGL PYTTLKEYLERNKERHENRVFYSTDEATQATYIELHKNQGLEVLFLDSFIDTHFINFLEREYQDVKFTRV DSDLDNTLLEQDKTGEIVDPTTNKTKSEVIKELFEKSLNKPKVNIRTEALKSDDPQGTPPAIVLLPEFLR RMREMTAMMQQQNTEFPEDHILLVNTAHPLIQNLVNLNQGAIIQGDGQSSTNPLVNLICQHVYDLALMSQ KGFDADGMKSFVERSNEVLTKLTQQTKN

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCTAGAGCAAGGCACCATCAGTATTCATACTGAGAATATTTTCCCAATTATCAAAAAATCTCTCTACTCAGACCATCAAATTTTCCT
GCGGGAACTAGTATCTAACGCTGTAGATGCCATCCAAAAGCTGAAAATGGTATCTCGTGCTGGAGAATATGCAGGAGTAGTCGAAGAACC
AGAAATTCAACTCGCCATCGACAAAGATAAAAAAACCCTGTCCATCACCGATAACGGTATCGGTATGACAGCAGAGGAAGTCAAAAAATA
TATTAATCAGGTCGCTTTTTCCAGTGCCGAAGAGTTTATTCATAAATATGAGGGAAAATCAGACCAGCCAATCATCGGTCACTTTGGTCT
GGGCTTCTACTCCTCCTTTATGGTGGCGCAGAAAGTAGAAATTGATACTCTGTCTTATCAAGAAGGCGCGCAAGCTGTTCACTGGAGTTG
TGACGGTTCCCCAGCATTCACCTTAGAAGAGTCACCCCGCACCACTCGCGGTACTACCATCACTTTGACTCTGTTACCAGACGAAGAAGA
ATATTTAGAATCTGCGCGGGTGAAAAACCTGGTCAAGACTTATTGCGACTTCATGCCAGTACCCATCAAACTGGATGGTGAAGTATTAAA
CAAGCAAAAAGCGCCGTGGCGGGAGTCTGCAAATAACCTAACGAAAGAAGATTATTTAGAATTTTACCGCTATCTCTATCCTTTTCAAGA
AGAACCCTTGTTGTGGGTGCATTTAAATACCGACTATCCCTTTATTATCAACGGGATTCTGTATTTTCCCAAGATGCGCCCCGATGTAGA
TGTTACCAAAGGACAAATCAAACTATTTTGCAATCAAGTTTTCGTCAGCGATAACTGCGAAGAGATTATTCCCCAGTTTCTCGTACCCAT
GCGGGGTGTAATCGATAGTACGGATATTCCCCTTAATGTATCACGTAGTGCCTTACAAGGCGATCGCACAGTCCGCAAAATCGGCGATTA
TATAGCCAAAAAAGTAGGCGACAGACTCAAAGAACTGTACCGCGATGACCGTGAACAATATATTAGTGCCTGGAAAGATTTAAGCACCTT
TGTCAAATTTGGTGTTCTCAACGACGAGAAATTCAAAAAGCAAGTCGAAGATATCGTTATTTTCCGCACCACCTTTAAATCAGCACCACC
AGCCGAAACACCAGCCGTTGAAGTACAGTCCCAAGAAGGTGATGTTTGGCAAGATGTCACCCCTACTTCCGACTCCCCCACACCAGGCTT
ACCATACACAACCCTGAAAGAATACTTAGAACGCAACAAAGAACGCCACGAAAATCGCGTCTTCTACAGCACCGATGAAGCAACCCAAGC
CACGTATATCGAACTACACAAAAACCAAGGCTTGGAAGTGCTGTTCCTCGACTCCTTCATCGACACCCACTTTATCAACTTCCTAGAGCG
GGAATATCAAGATGTCAAATTTACACGGGTAGACTCTGACTTAGATAATACCTTACTCGAACAAGACAAAACTGGAGAAATTGTTGACCC
CACAACAAATAAAACCAAGAGTGAGGTAATCAAAGAGTTATTTGAGAAATCCCTGAATAAACCTAAAGTCAATATTCGCACAGAAGCGCT
CAAGTCTGATGATCCTCAAGGTACACCACCGGCGATCGTTCTCTTACCAGAATTTCTGCGCCGCATGAGGGAAATGACCGCTATGATGCA
GCAGCAAAATACCGAGTTTCCCGAAGACCACATTTTACTAGTGAATACAGCCCATCCCCTAATTCAAAACTTGGTAAATCTCAACCAAGG
CGCAATTATTCAAGGCGACGGACAATCATCAACAAATCCCCTAGTAAACTTAATCTGCCAACACGTTTATGATTTGGCGCTGATGTCTCA
AAAAGGGTTTGACGCAGACGGAATGAAATCTTTTGTGGAACGTTCCAATGAAGTACTCACCAAGCTGACACAACAAACCAAAAATTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine64733 %
Guanine38020 %
Thyamine47525 %
Cytosine47525 %
A+T112257 %
G+C85544 %

Total Bases :   1977 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA5423
CTCTCT6123
AAAAAA20723
AAAAAA26123
GCGCGC42423
GAAGAAGAA53133
TATATA98723
AAAAAA99623
ATATAT104623
GCAGCAGCA170633

Microsatellite Map

ATGCTAGAGCAAGGCACCATCAGTATTCATACTGAGAATATTTTCCCAATTATCAAAAAATCTCTCTACTCAGACCATCAAATTTTCCTG
CGGGAACTAGTATCTAACGCTGTAGATGCCATCCAAAAGCTGAAAATGGTATCTCGTGCTGGAGAATATGCAGGAGTAGTCGAAGAACCA
GAAATTCAACTCGCCATCGACAAAGATAAAAAAACCCTGTCCATCACCGATAACGGTATCGGTATGACAGCAGAGGAAGTCAAAAAATAT
ATTAATCAGGTCGCTTTTTCCAGTGCCGAAGAGTTTATTCATAAATATGAGGGAAAATCAGACCAGCCAATCATCGGTCACTTTGGTCTG
GGCTTCTACTCCTCCTTTATGGTGGCGCAGAAAGTAGAAATTGATACTCTGTCTTATCAAGAAGGCGCGCAAGCTGTTCACTGGAGTTGT
GACGGTTCCCCAGCATTCACCTTAGAAGAGTCACCCCGCACCACTCGCGGTACTACCATCACTTTGACTCTGTTACCAGACGAAGAAGAA
TATTTAGAATCTGCGCGGGTGAAAAACCTGGTCAAGACTTATTGCGACTTCATGCCAGTACCCATCAAACTGGATGGTGAAGTATTAAAC
AAGCAAAAAGCGCCGTGGCGGGAGTCTGCAAATAACCTAACGAAAGAAGATTATTTAGAATTTTACCGCTATCTCTATCCTTTTCAAGAA
GAACCCTTGTTGTGGGTGCATTTAAATACCGACTATCCCTTTATTATCAACGGGATTCTGTATTTTCCCAAGATGCGCCCCGATGTAGAT
GTTACCAAAGGACAAATCAAACTATTTTGCAATCAAGTTTTCGTCAGCGATAACTGCGAAGAGATTATTCCCCAGTTTCTCGTACCCATG
CGGGGTGTAATCGATAGTACGGATATTCCCCTTAATGTATCACGTAGTGCCTTACAAGGCGATCGCACAGTCCGCAAAATCGGCGATTAT
ATAGCCAAAAAAGTAGGCGACAGACTCAAAGAACTGTACCGCGATGACCGTGAACAATATATTAGTGCCTGGAAAGATTTAAGCACCTTT
GTCAAATTTGGTGTTCTCAACGACGAGAAATTCAAAAAGCAAGTCGAAGATATCGTTATTTTCCGCACCACCTTTAAATCAGCACCACCA
GCCGAAACACCAGCCGTTGAAGTACAGTCCCAAGAAGGTGATGTTTGGCAAGATGTCACCCCTACTTCCGACTCCCCCACACCAGGCTTA
CCATACACAACCCTGAAAGAATACTTAGAACGCAACAAAGAACGCCACGAAAATCGCGTCTTCTACAGCACCGATGAAGCAACCCAAGCC
ACGTATATCGAACTACACAAAAACCAAGGCTTGGAAGTGCTGTTCCTCGACTCCTTCATCGACACCCACTTTATCAACTTCCTAGAGCGG
GAATATCAAGATGTCAAATTTACACGGGTAGACTCTGACTTAGATAATACCTTACTCGAACAAGACAAAACTGGAGAAATTGTTGACCCC
ACAACAAATAAAACCAAGAGTGAGGTAATCAAAGAGTTATTTGAGAAATCCCTGAATAAACCTAAAGTCAATATTCGCACAGAAGCGCTC
AAGTCTGATGATCCTCAAGGTACACCACCGGCGATCGTTCTCTTACCAGAATTTCTGCGCCGCATGAGGGAAATGACCGCTATGATGCAG
CAGCAAAATACCGAGTTTCCCGAAGACCACATTTTACTAGTGAATACAGCCCATCCCCTAATTCAAAACTTGGTAAATCTCAACCAAGGC
GCAATTATTCAAGGCGACGGACAATCATCAACAAATCCCCTAGTAAACTTAATCTGCCAACACGTTTATGATTTGGCGCTGATGTCTCAA
AAAGGGTTTGACGCAGACGGAATGAAATCTTTTGTGGAACGTTCCAATGAAGTACTCACCAAGCTGACACAACAAACCAAAAATTAG

Gene Information
Molecule Type genomic DNA
Bases 1977 Bases
Molecular Weight609540.21 Da
Coding Sequence CP000117.1:186736..188712
NCBI ReferenceABA19767
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 1 to 211 211 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 211 to 493 283 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 515 to 651 137 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_ANVA1

Accession Number

HSP90_0010

Added on

2012-02-02

Updated On

2014-01-20