Help  Custom Search
 
Chaperonine hsp90 protein, Chaperone protein htpG . of Agrobacterium vitis str. S4

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperonine hsp90 protein, Chaperone protein htpG .

Synonymous Names

B9JUH1_AGRVS, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Taxon Information

Organism

Agrobacterium vitis str. S4

Organism ID

311402 [NCBI] [UNIPROT]

Lineage

Bacteria;Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium vitis S4

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MSTETAEKPGETTPESHVFEADVARLLHMMVHSVYSDKDVFLRELVSNAADACEKLRYEAITTPGLLTSD PDPRIQLRLDADNRQLILEDNGIGMSRAELIEALGTIARSGTRAFMERIEASKADAAKTGEDAQLIGQFG VGFYSCFMVADKVDVVTRRAGETQAWIWSSDGKGSYSISEIDAESAPARGTRITLHLMEDAKDYATRARV ERIVKQQSGHVPVAITLVEKPGDEPTRITEGTALWTRPKSEISSEDYADFYRGIAGQYDEPALTVHFRAE GRHEYTALAFVPGTPPFDLFDPDRKGRIKLYVKRVFITDDAELLPRYLRFVRGLVDTADLPLNVSREMIQ ESPILSAIRKGVTNRILTSVEKLAQNEPETYKTLWENFGAVLKEGLYEDFERRSQLLGLTRFRTTTSGDD QRSLADYLKDLKPEQDSIYYLAGSNIEQLRASPQLEGFRARGIEVLLLSDQIDSFWVMNAPEFEGKTFKS VSQGAADLAKFAKADAGADSDQDSNDQAKADIAGFLALAKEQLKDQVADVRASDRLTESPVCLVAPESGY DRQLEKILAGAGQLASTSKPVLELNADHVLVKAMAGAQHTPALQNDAIHLLYDQARILDGEKPADARAFA ERMGRLLEKALRA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTCGACAGAAACAGCCGAAAAGCCGGGCGAAACTACGCCAGAATCACATGTGTTCGAAGCCGATGTGGCGCGCCTTCTGCATATGAT
GGTGCATTCGGTTTATTCGGACAAGGATGTGTTCCTGCGGGAACTGGTTTCCAATGCCGCTGATGCCTGCGAGAAACTACGCTATGAAGC
AATTACCACGCCGGGCCTTCTCACCAGCGATCCAGATCCCCGCATTCAGCTGCGGCTCGATGCCGATAACAGGCAATTGATCCTCGAAGA
CAATGGTATCGGCATGAGCCGGGCTGAGTTGATCGAAGCCCTGGGTACGATTGCCCGGTCTGGCACCCGTGCCTTCATGGAGCGGATCGA
GGCCAGCAAGGCGGACGCTGCCAAGACCGGCGAGGATGCCCAGTTGATCGGCCAGTTTGGTGTCGGCTTCTATTCCTGCTTCATGGTGGC
GGATAAGGTGGATGTGGTAACGCGCCGTGCCGGGGAGACGCAGGCCTGGATCTGGTCCTCAGACGGCAAGGGCAGCTATTCCATCAGCGA
GATCGATGCCGAGAGCGCACCAGCGCGTGGCACCCGCATCACTCTGCATTTGATGGAGGATGCCAAGGACTATGCTACCCGCGCCCGCGT
CGAGCGGATCGTCAAGCAGCAGTCAGGCCATGTGCCGGTTGCGATCACCCTGGTTGAAAAGCCCGGCGACGAACCAACCCGGATCACCGA
AGGCACAGCTCTCTGGACCCGCCCGAAATCCGAGATCAGCAGCGAGGACTATGCCGATTTCTATCGCGGCATTGCCGGTCAATATGACGA
ACCGGCCTTGACGGTGCATTTCCGCGCCGAAGGCCGCCATGAATATACCGCCCTTGCCTTCGTACCCGGCACGCCCCCTTTCGACCTGTT
TGATCCCGACCGCAAAGGCCGCATCAAGCTCTATGTGAAGCGGGTCTTCATCACCGACGATGCCGAACTTCTGCCGCGTTACCTGCGCTT
CGTGCGCGGCCTCGTCGATACCGCCGACCTGCCGCTGAACGTGTCGCGTGAAATGATCCAGGAAAGCCCGATCCTGTCGGCGATCCGCAA
GGGCGTGACCAATCGCATCCTGACCTCCGTGGAAAAACTGGCCCAGAACGAGCCGGAAACCTACAAGACGCTCTGGGAAAATTTCGGCGC
AGTGCTGAAAGAAGGGCTCTATGAGGATTTCGAACGGCGCAGCCAATTGCTGGGACTTACCCGTTTTCGCACCACGACATCAGGCGACGA
CCAGCGTAGCCTTGCCGACTATCTCAAGGACCTCAAGCCGGAACAGGACAGCATTTATTACCTGGCCGGGAGCAACATCGAACAGCTGAG
AGCCTCGCCGCAGCTGGAAGGTTTTCGCGCTCGTGGCATCGAGGTTCTACTGCTCTCAGACCAGATCGACAGTTTCTGGGTGATGAATGC
CCCGGAGTTTGAGGGCAAGACCTTCAAATCCGTTAGCCAGGGGGCAGCCGACCTTGCCAAATTCGCCAAGGCCGACGCCGGTGCTGATAG
CGACCAGGATAGCAACGACCAGGCAAAAGCCGATATTGCCGGATTCCTGGCACTCGCCAAGGAGCAGTTGAAAGATCAGGTTGCCGATGT
CCGCGCCTCAGACCGGCTGACGGAAAGCCCGGTCTGCCTCGTTGCGCCGGAAAGCGGTTATGACCGTCAGCTGGAGAAAATATTGGCAGG
TGCAGGCCAACTGGCCTCAACCTCCAAGCCGGTGCTGGAGCTGAATGCCGATCACGTGCTGGTAAAAGCCATGGCTGGTGCCCAACATAC
GCCTGCCCTGCAAAATGATGCGATCCACCTGCTGTATGATCAGGCCCGCATTCTCGATGGTGAAAAACCAGCCGACGCCCGGGCCTTTGC
GGAGCGCATGGGACGGCTGCTCGAAAAGGCGCTTCGCGCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine42823 %
Guanine56530 %
Thyamine36419 %
Cytosine57530 %
A+T79241 %
G+C114060 %

Total Bases :   1932 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC6923
CTCTCT72723

Microsatellite Map

ATGTCGACAGAAACAGCCGAAAAGCCGGGCGAAACTACGCCAGAATCACATGTGTTCGAAGCCGATGTGGCGCGCCTTCTGCATATGATG
GTGCATTCGGTTTATTCGGACAAGGATGTGTTCCTGCGGGAACTGGTTTCCAATGCCGCTGATGCCTGCGAGAAACTACGCTATGAAGCA
ATTACCACGCCGGGCCTTCTCACCAGCGATCCAGATCCCCGCATTCAGCTGCGGCTCGATGCCGATAACAGGCAATTGATCCTCGAAGAC
AATGGTATCGGCATGAGCCGGGCTGAGTTGATCGAAGCCCTGGGTACGATTGCCCGGTCTGGCACCCGTGCCTTCATGGAGCGGATCGAG
GCCAGCAAGGCGGACGCTGCCAAGACCGGCGAGGATGCCCAGTTGATCGGCCAGTTTGGTGTCGGCTTCTATTCCTGCTTCATGGTGGCG
GATAAGGTGGATGTGGTAACGCGCCGTGCCGGGGAGACGCAGGCCTGGATCTGGTCCTCAGACGGCAAGGGCAGCTATTCCATCAGCGAG
ATCGATGCCGAGAGCGCACCAGCGCGTGGCACCCGCATCACTCTGCATTTGATGGAGGATGCCAAGGACTATGCTACCCGCGCCCGCGTC
GAGCGGATCGTCAAGCAGCAGTCAGGCCATGTGCCGGTTGCGATCACCCTGGTTGAAAAGCCCGGCGACGAACCAACCCGGATCACCGAA
GGCACAGCTCTCTGGACCCGCCCGAAATCCGAGATCAGCAGCGAGGACTATGCCGATTTCTATCGCGGCATTGCCGGTCAATATGACGAA
CCGGCCTTGACGGTGCATTTCCGCGCCGAAGGCCGCCATGAATATACCGCCCTTGCCTTCGTACCCGGCACGCCCCCTTTCGACCTGTTT
GATCCCGACCGCAAAGGCCGCATCAAGCTCTATGTGAAGCGGGTCTTCATCACCGACGATGCCGAACTTCTGCCGCGTTACCTGCGCTTC
GTGCGCGGCCTCGTCGATACCGCCGACCTGCCGCTGAACGTGTCGCGTGAAATGATCCAGGAAAGCCCGATCCTGTCGGCGATCCGCAAG
GGCGTGACCAATCGCATCCTGACCTCCGTGGAAAAACTGGCCCAGAACGAGCCGGAAACCTACAAGACGCTCTGGGAAAATTTCGGCGCA
GTGCTGAAAGAAGGGCTCTATGAGGATTTCGAACGGCGCAGCCAATTGCTGGGACTTACCCGTTTTCGCACCACGACATCAGGCGACGAC
CAGCGTAGCCTTGCCGACTATCTCAAGGACCTCAAGCCGGAACAGGACAGCATTTATTACCTGGCCGGGAGCAACATCGAACAGCTGAGA
GCCTCGCCGCAGCTGGAAGGTTTTCGCGCTCGTGGCATCGAGGTTCTACTGCTCTCAGACCAGATCGACAGTTTCTGGGTGATGAATGCC
CCGGAGTTTGAGGGCAAGACCTTCAAATCCGTTAGCCAGGGGGCAGCCGACCTTGCCAAATTCGCCAAGGCCGACGCCGGTGCTGATAGC
GACCAGGATAGCAACGACCAGGCAAAAGCCGATATTGCCGGATTCCTGGCACTCGCCAAGGAGCAGTTGAAAGATCAGGTTGCCGATGTC
CGCGCCTCAGACCGGCTGACGGAAAGCCCGGTCTGCCTCGTTGCGCCGGAAAGCGGTTATGACCGTCAGCTGGAGAAAATATTGGCAGGT
GCAGGCCAACTGGCCTCAACCTCCAAGCCGGTGCTGGAGCTGAATGCCGATCACGTGCTGGTAAAAGCCATGGCTGGTGCCCAACATACG
CCTGCCCTGCAAAATGATGCGATCCACCTGCTGTATGATCAGGCCCGCATTCTCGATGGTGAAAAACCAGCCGACGCCCGGGCCTTTGCG
GAGCGCATGGGACGGCTGCTCGAAAAGGCGCTTCGCGCCTGA

Gene Information
Molecule Type genomic DNA
Bases 1932 Bases
Molecular Weight597002.87 Da
Coding Sequence CP000633.1:3591544..3593475
NCBI ReferenceACM38094
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 13 to 234 222 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 240 to 494 255 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 524 to 639 116 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_AGVI1

Accession Number

HSP90_0009

Added on

2012-02-02

Updated On

2014-01-20