Help  Custom Search
 
Heat shock chaperone protein. of Agrobacterium radiobacter str. K84

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock chaperone protein.

Synonymous Names

B9JJ25_AGRRK, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

Arad_8710

Gene Identifier

7365999

Taxon Information

Organism

Agrobacterium radiobacter str. K84

Organism ID

311403 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium radiobacter K84

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MTTTTAENPAESHVFEADVARLLHMMVHSVYSDKDVFLRELISNAADACEKLRYEAIATPSLLASDPDSR ILLTLDEEGSRLVVEDNGIGMSRDEMIEALGTIARSGTRAFMERIEANKQGEGAQLIGQFGVGFYSCFMV ADRVDVVSRRAGTDDAWLWSSDGKGGYSVSPIDVSEAPARGTRITLHLMEDAKSYASRWTVERIVKAQSG HVPVPITIAEKPGAEATQLTDGTALWTKSKNDITNEEYTDFYRGISGQYDEPALTVHFRAEGRHEYSALA FIPGSQPFDLFDPDRKGRMKLYVKRVFITDEAELLPRYLRFVRGLVDTSDLPLNVSREMIQESAILSAIR KGVTNRIITAIEKLAESDNDAFLKLWESFGSLIKEGIYEDYERRSQLVALSRFRTTASGEGYRSLADYVK DIKEGQQAIYYLAGNSLEQLKASPQLEGFRARGIEVLLLSDSVDSFWVTNAPEFEGKAFKSITQGSADLA QFSKVEQDATKDEAAPAEVQAFIDFAKDKLSDQVSDVRASDRLIESAVCLVASEQGYDRQLEKILQGAGQ LQSAAKPILEINGDHPLVKAIAAKGDQSSLRDDAAFLLLDQARVLDGDKPADPRAFAERLVRVMEKALQ

FASTA Format Composition Secondary Structure

Nucleotide
 ATGACGACAACCACCGCAGAAAATCCCGCCGAAAGCCATGTTTTTGAGGCCGACGTTGCCCGTCTTCTGCATATGATGGTTCACTCGGT
TTATTCCGATAAGGATGTATTTCTACGCGAGCTGATTTCGAACGCGGCTGACGCCTGTGAGAAGCTTCGATACGAGGCGATCGCCACGCC
TTCGCTGCTGGCAAGCGATCCGGACAGCCGTATCCTGCTGACGCTGGATGAGGAGGGCAGCCGGCTTGTTGTCGAGGACAACGGCATCGG
CATGAGCCGCGACGAGATGATCGAAGCACTCGGAACGATCGCCCGTTCCGGTACGCGCGCCTTCATGGAGCGTATCGAGGCGAACAAGCA
GGGCGAGGGCGCGCAGCTGATCGGTCAGTTCGGCGTTGGCTTCTATTCCTGCTTCATGGTCGCCGATCGCGTCGATGTCGTCTCGCGCCG
CGCCGGCACGGATGATGCCTGGCTCTGGTCCTCCGACGGCAAGGGCGGCTACAGCGTCAGCCCGATCGATGTCAGCGAGGCGCCGGCCCG
CGGCACGCGCATCACTCTGCATCTGATGGAGGATGCCAAGAGCTACGCGTCCCGCTGGACCGTCGAGCGGATCGTCAAGGCACAATCGGG
TCATGTGCCCGTACCGATCACGATCGCCGAAAAGCCCGGTGCGGAGGCGACGCAGCTGACTGACGGCACGGCGCTCTGGACGAAATCGAA
AAACGATATCACCAACGAGGAATATACCGATTTCTATCGCGGAATTTCGGGCCAGTATGACGAGCCGGCGCTGACGGTGCATTTCCGCGC
CGAAGGCCGCCACGAATATTCCGCGCTTGCCTTCATTCCCGGTTCCCAGCCTTTCGACCTCTTCGATCCCGATCGTAAGGGCCGAATGAA
GCTCTATGTGAAGCGCGTCTTCATCACCGATGAGGCCGAATTGCTGCCGCGCTATCTCCGTTTCGTGCGCGGTCTCGTCGACACCTCCGA
TCTGCCGCTGAACGTCTCGCGCGAAATGATCCAGGAAAGCGCCATCCTCTCGGCGATCCGCAAGGGCGTCACCAACAGGATCATTACCGC
CATCGAGAAGCTTGCGGAAAGCGACAATGATGCTTTCCTCAAACTCTGGGAATCGTTCGGAAGCCTGATCAAGGAAGGCATTTACGAGGA
TTACGAGCGGCGCAGCCAACTGGTCGCGCTGTCGCGCTTCCGCACGACGGCATCCGGGGAGGGCTATCGTTCTCTTGCCGACTACGTCAA
GGATATCAAGGAAGGCCAGCAGGCGATCTATTATCTCGCCGGCAACAGCCTCGAACAGCTGAAGGCATCGCCGCAGCTCGAAGGGTTTCG
TGCCCGCGGCATCGAGGTGCTGCTGCTCTCGGATTCCGTCGACAGCTTCTGGGTGACGAACGCGCCGGAGTTCGAAGGCAAGGCGTTCAA
GTCGATCACGCAAGGGTCGGCCGATCTCGCCCAGTTCAGCAAGGTCGAGCAGGACGCGACCAAGGACGAGGCAGCGCCGGCGGAGGTTCA
GGCTTTCATCGATTTCGCCAAGGATAAGCTCTCGGATCAGGTTTCCGATGTTCGCGCATCGGACCGCCTGATCGAAAGCGCCGTCTGCCT
GGTCGCCTCCGAACAGGGCTACGACCGCCAGCTCGAAAAAATCCTGCAGGGCGCCGGGCAGCTGCAATCCGCTGCAAAGCCGATCCTGGA
AATCAATGGCGATCACCCGCTCGTCAAGGCCATCGCCGCCAAGGGCGACCAGTCGTCCCTGCGCGACGACGCGGCATTCCTGCTGCTCGA
CCAGGCGCGTGTCCTTGATGGCGACAAGCCGGCCGACCCGCGTGCCTTTGCCGAGCGGCTGGTGCGCGTGATGGAAAAGGCTTTGCAGTA
G 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine38121 %
Guanine57531 %
Thyamine35719 %
Cytosine57731 %
A+T73840 %
G+C115261 %

Total Bases :   1890 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG32223
GCGCGC36723
CGCGCG100623
TGCTGCTGC136633
AAAAAA165423

Microsatellite Map

ATGACGACAACCACCGCAGAAAATCCCGCCGAAAGCCATGTTTTTGAGGCCGACGTTGCCCGTCTTCTGCATATGATGGTTCACTCGGTT
TATTCCGATAAGGATGTATTTCTACGCGAGCTGATTTCGAACGCGGCTGACGCCTGTGAGAAGCTTCGATACGAGGCGATCGCCACGCCT
TCGCTGCTGGCAAGCGATCCGGACAGCCGTATCCTGCTGACGCTGGATGAGGAGGGCAGCCGGCTTGTTGTCGAGGACAACGGCATCGGC
ATGAGCCGCGACGAGATGATCGAAGCACTCGGAACGATCGCCCGTTCCGGTACGCGCGCCTTCATGGAGCGTATCGAGGCGAACAAGCAG
GGCGAGGGCGCGCAGCTGATCGGTCAGTTCGGCGTTGGCTTCTATTCCTGCTTCATGGTCGCCGATCGCGTCGATGTCGTCTCGCGCCGC
GCCGGCACGGATGATGCCTGGCTCTGGTCCTCCGACGGCAAGGGCGGCTACAGCGTCAGCCCGATCGATGTCAGCGAGGCGCCGGCCCGC
GGCACGCGCATCACTCTGCATCTGATGGAGGATGCCAAGAGCTACGCGTCCCGCTGGACCGTCGAGCGGATCGTCAAGGCACAATCGGGT
CATGTGCCCGTACCGATCACGATCGCCGAAAAGCCCGGTGCGGAGGCGACGCAGCTGACTGACGGCACGGCGCTCTGGACGAAATCGAAA
AACGATATCACCAACGAGGAATATACCGATTTCTATCGCGGAATTTCGGGCCAGTATGACGAGCCGGCGCTGACGGTGCATTTCCGCGCC
GAAGGCCGCCACGAATATTCCGCGCTTGCCTTCATTCCCGGTTCCCAGCCTTTCGACCTCTTCGATCCCGATCGTAAGGGCCGAATGAAG
CTCTATGTGAAGCGCGTCTTCATCACCGATGAGGCCGAATTGCTGCCGCGCTATCTCCGTTTCGTGCGCGGTCTCGTCGACACCTCCGAT
CTGCCGCTGAACGTCTCGCGCGAAATGATCCAGGAAAGCGCCATCCTCTCGGCGATCCGCAAGGGCGTCACCAACAGGATCATTACCGCC
ATCGAGAAGCTTGCGGAAAGCGACAATGATGCTTTCCTCAAACTCTGGGAATCGTTCGGAAGCCTGATCAAGGAAGGCATTTACGAGGAT
TACGAGCGGCGCAGCCAACTGGTCGCGCTGTCGCGCTTCCGCACGACGGCATCCGGGGAGGGCTATCGTTCTCTTGCCGACTACGTCAAG
GATATCAAGGAAGGCCAGCAGGCGATCTATTATCTCGCCGGCAACAGCCTCGAACAGCTGAAGGCATCGCCGCAGCTCGAAGGGTTTCGT
GCCCGCGGCATCGAGGTGCTGCTGCTCTCGGATTCCGTCGACAGCTTCTGGGTGACGAACGCGCCGGAGTTCGAAGGCAAGGCGTTCAAG
TCGATCACGCAAGGGTCGGCCGATCTCGCCCAGTTCAGCAAGGTCGAGCAGGACGCGACCAAGGACGAGGCAGCGCCGGCGGAGGTTCAG
GCTTTCATCGATTTCGCCAAGGATAAGCTCTCGGATCAGGTTTCCGATGTTCGCGCATCGGACCGCCTGATCGAAAGCGCCGTCTGCCTG
GTCGCCTCCGAACAGGGCTACGACCGCCAGCTCGAAAAAATCCTGCAGGGCGCCGGGCAGCTGCAATCCGCTGCAAAGCCGATCCTGGAA
ATCAATGGCGATCACCCGCTCGTCAAGGCCATCGCCGCCAAGGGCGACCAGTCGTCCCTGCGCGACGACGCGGCATTCCTGCTGCTCGAC
CAGGCGCGTGTCCTTGATGGCGACAAGCCGGCCGACCCGCGTGCCTTTGCCGAGCGGCTGGTGCGCGTGATGGAAAAGGCTTTGCAGTAG

Gene Information
Molecule Type genomic DNA
Bases 1890 Bases
Molecular Weight584023.06 Da
Coding Sequence CP000629.1:1491622..1493511
NCBI ReferenceACM29917
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 9 to 225 217 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 231 to 485 255 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 511 to 626 116 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_AGRA1

Accession Number

HSP90_0008

Added on

2012-02-02

Updated On

2014-01-20