Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Aeromonas hydrophila subsp. hydrophila str. ATCC7966

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_AERHH, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

AHA_2490

Gene Identifier

4490791

Taxon Information

Organism

Aeromonas hydrophila subsp. hydrophila str. ATCC7966

Organism ID

380703 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales; Aeromonadaceae; Aeromonas; Aeromonas hydrophila subsp. hydrophila ATCC 7966

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MTQSVHAETHGFQTEVKQLLSLMAHSLYSNKEVFLRELISNASDAADKLRFKALSDASLFENDGQLRVRL VVDKENRTLTISDNGIGMTRDQVIEHLGTIAKSGTAEFFKNLSGDQGRDSQLIGQFGVGFYSAFIVADKV TVVSRAAGTAPEQGVQWESEGEGSFTVADVTKAGRGTDVILHLRAEEDEFLDDWRLRSVVSKYSDHISVP VEMYKEGTPDSVGEGEEDGETIVGTPGEWEQVNRATALWTRNPKEIKDEEYQEFYKHVAHDFEDPLLWGH NRVEGAQEYTSLLYVPARAPFDLYNRDQKHGLKLYVQRVFIMDDAEQFMPAYLRFVKGVLDSNDLPLNVS REILQDNKVTVSLRKACSKRVLTMLAKLAKDDAEKYAKFWSEFGNVLKEGPAEDYANREEIAKLLRFAST AGEGEAQTVSLEDYVGRMKEGQQKIYYITADSYAAAKNSPHLEIFRKKGVEVLLMWERVDEWLMSHLTEF DGKQLVSVTRGELDLGDLEDEASKQAQEEAEKANAGLVERVKQSLGEAVKEVRVTHRLTDSPSCIVTDAH GMSTQMIKLMRAAGQPVPEQKYILELNPDHALVKKLGAIEDEALFGEWVTLLHEQAQLAEQGGLNDPASF VSRINRLLLQA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGACCCAAAGCGTTCATGCCGAAACCCACGGGTTTCAGACTGAAGTCAAACAACTGCTGAGCCTGATGGCCCACAGCCTCTACTCCAA
CAAAGAAGTGTTCCTGCGCGAGCTGATTTCCAACGCCTCCGATGCGGCGGACAAGCTGCGCTTCAAGGCGCTTTCCGATGCCTCTTTGTT
CGAAAACGACGGCCAGTTGCGCGTTCGCCTGGTGGTTGATAAAGAAAATCGGACCCTGACCATCTCCGACAACGGGATCGGTATGACCCG
TGATCAGGTGATCGAGCACCTGGGCACCATCGCCAAGTCCGGCACCGCCGAGTTCTTCAAGAACCTCTCCGGTGATCAGGGCCGCGACTC
CCAGCTGATCGGTCAGTTCGGGGTGGGCTTCTACTCCGCCTTCATCGTCGCCGACAAGGTGACCGTGGTGTCCCGCGCCGCCGGTACTGC
TCCGGAGCAGGGCGTGCAGTGGGAGTCGGAAGGGGAAGGCTCCTTCACCGTGGCTGACGTGACCAAAGCCGGTCGCGGTACCGACGTCAT
CCTGCACCTGCGCGCCGAAGAGGACGAGTTCCTCGACGACTGGCGTCTGCGCTCCGTGGTCAGCAAATATTCCGACCACATCAGCGTGCC
GGTGGAGATGTACAAAGAGGGCACCCCGGATAGTGTTGGAGAGGGCGAAGAAGATGGCGAGACCATCGTCGGCACCCCGGGCGAGTGGGA
GCAGGTCAACCGCGCCACTGCGCTGTGGACCCGCAACCCGAAAGAGATCAAGGACGAGGAGTATCAGGAGTTCTACAAGCACGTCGCTCA
CGACTTCGAAGATCCGCTCTTGTGGGGTCACAACCGGGTGGAAGGGGCACAGGAGTACACCAGCCTGCTCTACGTGCCGGCCCGCGCACC
GTTCGACCTTTACAACCGGGATCAGAAACACGGCCTGAAGCTCTACGTACAGCGCGTCTTCATCATGGACGACGCCGAGCAGTTCATGCC
GGCTTACCTGCGCTTCGTCAAAGGGGTGCTGGACTCCAACGATCTGCCGCTCAACGTCAGCCGTGAGATCCTGCAAGACAACAAGGTGAC
CGTCTCCCTGCGCAAGGCCTGCTCCAAGCGCGTGCTGACCATGCTCGCCAAGCTGGCCAAGGATGATGCCGAGAAGTACGCCAAGTTCTG
GAGCGAGTTCGGCAATGTGCTCAAAGAAGGCCCGGCCGAGGATTACGCCAACCGCGAAGAGATCGCCAAGCTCTTGCGCTTTGCCAGCAC
CGCCGGCGAGGGTGAAGCCCAGACCGTGTCGCTGGAGGATTACGTTGGCCGCATGAAGGAAGGCCAGCAGAAGATTTATTACATCACCGC
CGACTCTTACGCTGCCGCCAAGAACAGCCCGCACCTCGAGATCTTCCGCAAGAAGGGTGTCGAAGTGCTGCTGATGTGGGAGCGGGTCGA
CGAGTGGCTGATGAGCCACCTGACCGAGTTCGACGGCAAGCAGCTGGTCTCCGTCACCCGTGGCGAGCTGGATCTCGGCGATCTGGAAGA
CGAAGCCTCCAAACAGGCGCAGGAAGAGGCCGAGAAAGCCAACGCCGGTCTGGTGGAGCGGGTCAAGCAGAGCTTGGGTGAGGCGGTAAA
AGAGGTGCGCGTCACCCACCGTCTGACCGACTCACCGTCTTGCATCGTCACCGATGCCCACGGCATGAGCACCCAGATGATCAAGCTGAT
GCGCGCCGCCGGCCAGCCGGTGCCGGAGCAGAAGTACATTCTGGAACTGAACCCCGACCACGCCCTGGTGAAGAAGTTGGGCGCCATCGA
AGACGAGGCGCTGTTCGGCGAGTGGGTCACCCTCTTGCACGAACAGGCCCAGCTGGCCGAGCAGGGCGGGCTCAATGATCCGGCGAGCTT
CGTCTCCCGTATCAACCGTCTGTTACTCCAGGCATGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine42022 %
Guanine59231 %
Thyamine33018 %
Cytosine58431 %
A+T75039 %
G+C117662 %

Total Bases :   1926 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC54823
GCGCGC170923

Microsatellite Map

ATGACCCAAAGCGTTCATGCCGAAACCCACGGGTTTCAGACTGAAGTCAAACAACTGCTGAGCCTGATGGCCCACAGCCTCTACTCCAAC
AAAGAAGTGTTCCTGCGCGAGCTGATTTCCAACGCCTCCGATGCGGCGGACAAGCTGCGCTTCAAGGCGCTTTCCGATGCCTCTTTGTTC
GAAAACGACGGCCAGTTGCGCGTTCGCCTGGTGGTTGATAAAGAAAATCGGACCCTGACCATCTCCGACAACGGGATCGGTATGACCCGT
GATCAGGTGATCGAGCACCTGGGCACCATCGCCAAGTCCGGCACCGCCGAGTTCTTCAAGAACCTCTCCGGTGATCAGGGCCGCGACTCC
CAGCTGATCGGTCAGTTCGGGGTGGGCTTCTACTCCGCCTTCATCGTCGCCGACAAGGTGACCGTGGTGTCCCGCGCCGCCGGTACTGCT
CCGGAGCAGGGCGTGCAGTGGGAGTCGGAAGGGGAAGGCTCCTTCACCGTGGCTGACGTGACCAAAGCCGGTCGCGGTACCGACGTCATC
CTGCACCTGCGCGCCGAAGAGGACGAGTTCCTCGACGACTGGCGTCTGCGCTCCGTGGTCAGCAAATATTCCGACCACATCAGCGTGCCG
GTGGAGATGTACAAAGAGGGCACCCCGGATAGTGTTGGAGAGGGCGAAGAAGATGGCGAGACCATCGTCGGCACCCCGGGCGAGTGGGAG
CAGGTCAACCGCGCCACTGCGCTGTGGACCCGCAACCCGAAAGAGATCAAGGACGAGGAGTATCAGGAGTTCTACAAGCACGTCGCTCAC
GACTTCGAAGATCCGCTCTTGTGGGGTCACAACCGGGTGGAAGGGGCACAGGAGTACACCAGCCTGCTCTACGTGCCGGCCCGCGCACCG
TTCGACCTTTACAACCGGGATCAGAAACACGGCCTGAAGCTCTACGTACAGCGCGTCTTCATCATGGACGACGCCGAGCAGTTCATGCCG
GCTTACCTGCGCTTCGTCAAAGGGGTGCTGGACTCCAACGATCTGCCGCTCAACGTCAGCCGTGAGATCCTGCAAGACAACAAGGTGACC
GTCTCCCTGCGCAAGGCCTGCTCCAAGCGCGTGCTGACCATGCTCGCCAAGCTGGCCAAGGATGATGCCGAGAAGTACGCCAAGTTCTGG
AGCGAGTTCGGCAATGTGCTCAAAGAAGGCCCGGCCGAGGATTACGCCAACCGCGAAGAGATCGCCAAGCTCTTGCGCTTTGCCAGCACC
GCCGGCGAGGGTGAAGCCCAGACCGTGTCGCTGGAGGATTACGTTGGCCGCATGAAGGAAGGCCAGCAGAAGATTTATTACATCACCGCC
GACTCTTACGCTGCCGCCAAGAACAGCCCGCACCTCGAGATCTTCCGCAAGAAGGGTGTCGAAGTGCTGCTGATGTGGGAGCGGGTCGAC
GAGTGGCTGATGAGCCACCTGACCGAGTTCGACGGCAAGCAGCTGGTCTCCGTCACCCGTGGCGAGCTGGATCTCGGCGATCTGGAAGAC
GAAGCCTCCAAACAGGCGCAGGAAGAGGCCGAGAAAGCCAACGCCGGTCTGGTGGAGCGGGTCAAGCAGAGCTTGGGTGAGGCGGTAAAA
GAGGTGCGCGTCACCCACCGTCTGACCGACTCACCGTCTTGCATCGTCACCGATGCCCACGGCATGAGCACCCAGATGATCAAGCTGATG
CGCGCCGCCGGCCAGCCGGTGCCGGAGCAGAAGTACATTCTGGAACTGAACCCCGACCACGCCCTGGTGAAGAAGTTGGGCGCCATCGAA
GACGAGGCGCTGTTCGGCGAGTGGGTCACCCTCTTGCACGAACAGGCCCAGCTGGCCGAGCAGGGCGGGCTCAATGATCCGGCGAGCTTC
GTCTCCCGTATCAACCGTCTGTTACTCCAGGCATGA

Gene Information
Molecule Type genomic DNA
Bases 1926 Bases
Molecular Weight595645.68 Da
Coding Sequence complement(CP000462.1:2768795..2770720)
NCBI ReferenceABK38983
Notesidentified by similarity to SP:P0A6Z3; match to

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 6 to 220 215 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 244 to 501 258 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 526 to 640 115 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_AEHY1

Accession Number

HSP90_0007

Added on

2012-02-02

Updated On

2014-01-20