Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Actinobacillus succinogenes str. 130Z

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_ACTSZ, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

Asuc_0839

Gene Identifier

5348875

Taxon Information

Organism

Actinobacillus succinogenes str. 130Z

Organism ID

339671 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus sucoiled coilinogenes 130Z

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MSNNQQTLGFQTEVKQLLQLMIHSLYSNKEIFLRELISNASDAADKLRFKALSAPELYEGDGDLKVRIRF DEKKGTLTVSDNGIGMTREQATEHLGTIAKSGTKEFLTALGQDQAKDSQLIGQFGVGFYSAFIVADKVEV RSRAAGVPAEQGVLWTSAGEGEYSVEDIEKKERGTEITLFLREDEKEFLNEWRLREIIGKYSDHIGLPVE ILTKEFDEEGKESDVKWEKINKAQALWTRAKGEISDEEYQEFYKHISHDFADPLVWQHNKVEGNQEYTSL LYVPSKAPWDLFNREQKHGLKLYVQRVFIMDDAEVFMPNYLRFMRGLLDSNDLPLNVSREILQDNKTTAA LRKALTKRSLQMLEKLAKDEAEKYATFWKEFGLVLKEGVGEDFANREQIAKLFRFASTHTDSSEQSVSLA DYIARMKEGQKAVYYITADSYVAAKNSPHLELFNKKGIEVLLLSDRIDEWMLSYLTEFDGKPLQSITKAD LDLGDLADKTEAEKEKAQDEALSGFIERVKTLLGERVKDVRLTHRLTDTPAVVSTDNDQMTTQMAKLFAM SGQPVPEVKYTFELNPDHALVKKTAALTDESAFADWVELLLEQAMLSERGTLENPTAFIKRVNTLLAG

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGCAATAATCAACAAACTCTCGGTTTCCAAACGGAAGTGAAACAACTTCTGCAATTAATGATTCATTCCCTGTATTCCAATAAGGA
AATTTTTCTGCGCGAATTGATTTCCAACGCGTCCGATGCGGCGGATAAATTGCGTTTCAAAGCGCTTTCCGCGCCGGAACTGTATGAAGG
CGACGGCGATTTGAAAGTGCGCATTCGTTTTGATGAGAAAAAAGGTACGCTGACCGTCAGCGATAACGGCATCGGCATGACGCGCGAACA
GGCGACGGAACACCTGGGCACCATTGCGAAATCCGGAACAAAGGAATTTTTAACCGCACTTGGGCAGGATCAAGCCAAAGACAGCCAGTT
AATCGGTCAATTCGGGGTGGGATTCTATTCCGCCTTTATCGTAGCGGACAAAGTGGAAGTACGCAGCCGTGCAGCGGGTGTGCCGGCGGA
ACAGGGCGTATTATGGACATCTGCCGGCGAAGGCGAGTATTCCGTCGAAGATATTGAGAAAAAAGAACGCGGTACGGAAATTACGCTGTT
TTTGCGCGAGGACGAAAAAGAATTTTTGAACGAATGGCGTCTGCGTGAAATTATCGGCAAATATTCCGATCACATCGGTTTGCCGGTGGA
AATTCTGACCAAAGAATTCGATGAAGAAGGCAAAGAAAGCGACGTAAAATGGGAAAAAATCAATAAAGCTCAGGCCTTGTGGACGAGGGC
GAAAGGTGAAATCTCCGACGAAGAATACCAAGAATTTTATAAACATATCAGCCATGATTTTGCCGATCCGCTAGTATGGCAGCACAACAA
AGTGGAAGGTAATCAGGAATATACCAGTTTGCTTTATGTGCCGTCCAAAGCGCCGTGGGATTTATTCAACCGCGAGCAAAAACACGGCTT
GAAGCTGTATGTGCAACGGGTATTCATTATGGATGATGCGGAAGTGTTCATGCCGAATTATCTGCGTTTCATGCGCGGTTTGCTGGACAG
CAACGATTTGCCGTTAAACGTTTCCCGTGAAATTCTGCAGGATAATAAAACCACGGCGGCATTACGTAAAGCCTTAACCAAACGTTCCTT
ACAAATGCTGGAAAAACTGGCGAAAGACGAAGCGGAAAAATATGCGACATTCTGGAAAGAATTCGGTTTAGTGCTGAAAGAAGGCGTGGG
TGAAGATTTTGCCAACCGCGAACAAATCGCCAAACTATTCCGTTTTGCTTCCACTCACACGGACAGCAGCGAACAAAGCGTATCGCTGGC
GGATTATATCGCCCGCATGAAAGAAGGACAAAAAGCCGTTTACTATATTACCGCCGACAGTTACGTCGCGGCGAAAAACAGTCCGCATTT
GGAATTGTTCAATAAAAAAGGCATTGAAGTGTTGCTGTTGTCCGATCGAATCGACGAATGGATGTTGAGCTATTTAACGGAATTTGACGG
CAAGCCGTTACAATCCATCACCAAAGCGGATTTGGATTTAGGCGATTTGGCGGATAAAACCGAAGCGGAAAAAGAGAAGGCGCAGGACGA
AGCTTTAAGCGGTTTCATCGAACGGGTGAAAACCCTGCTGGGCGAACGGGTAAAAGATGTGCGTTTGACCCATCGTTTAACCGATACGCC
GGCGGTGGTATCGACGGATAACGATCAAATGACTACTCAAATGGCGAAATTGTTCGCGATGAGCGGTCAGCCGGTGCCGGAGGTGAAATA
TACTTTTGAATTGAATCCGGATCACGCTTTAGTGAAAAAAACGGCGGCATTGACCGATGAATCCGCTTTCGCCGACTGGGTGGAATTGCT
GTTGGAGCAAGCCATGTTGTCGGAGCGCGGCACCTTGGAAAATCCGACGGCTTTCATTAAACGCGTGAATACCTTGCTTGCAGGCTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine56330 %
Guanine50127 %
Thyamine43023 %
Cytosine39321 %
A+T99353 %
G+C89448 %

Total Bases :   1887 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA21623
CGCGCG25923
AAAAAA50723
AAAAAA68223
AAAAAA136223
AAAAAA174323

Microsatellite Map

ATGAGCAATAATCAACAAACTCTCGGTTTCCAAACGGAAGTGAAACAACTTCTGCAATTAATGATTCATTCCCTGTATTCCAATAAGGAA
ATTTTTCTGCGCGAATTGATTTCCAACGCGTCCGATGCGGCGGATAAATTGCGTTTCAAAGCGCTTTCCGCGCCGGAACTGTATGAAGGC
GACGGCGATTTGAAAGTGCGCATTCGTTTTGATGAGAAAAAAGGTACGCTGACCGTCAGCGATAACGGCATCGGCATGACGCGCGAACAG
GCGACGGAACACCTGGGCACCATTGCGAAATCCGGAACAAAGGAATTTTTAACCGCACTTGGGCAGGATCAAGCCAAAGACAGCCAGTTA
ATCGGTCAATTCGGGGTGGGATTCTATTCCGCCTTTATCGTAGCGGACAAAGTGGAAGTACGCAGCCGTGCAGCGGGTGTGCCGGCGGAA
CAGGGCGTATTATGGACATCTGCCGGCGAAGGCGAGTATTCCGTCGAAGATATTGAGAAAAAAGAACGCGGTACGGAAATTACGCTGTTT
TTGCGCGAGGACGAAAAAGAATTTTTGAACGAATGGCGTCTGCGTGAAATTATCGGCAAATATTCCGATCACATCGGTTTGCCGGTGGAA
ATTCTGACCAAAGAATTCGATGAAGAAGGCAAAGAAAGCGACGTAAAATGGGAAAAAATCAATAAAGCTCAGGCCTTGTGGACGAGGGCG
AAAGGTGAAATCTCCGACGAAGAATACCAAGAATTTTATAAACATATCAGCCATGATTTTGCCGATCCGCTAGTATGGCAGCACAACAAA
GTGGAAGGTAATCAGGAATATACCAGTTTGCTTTATGTGCCGTCCAAAGCGCCGTGGGATTTATTCAACCGCGAGCAAAAACACGGCTTG
AAGCTGTATGTGCAACGGGTATTCATTATGGATGATGCGGAAGTGTTCATGCCGAATTATCTGCGTTTCATGCGCGGTTTGCTGGACAGC
AACGATTTGCCGTTAAACGTTTCCCGTGAAATTCTGCAGGATAATAAAACCACGGCGGCATTACGTAAAGCCTTAACCAAACGTTCCTTA
CAAATGCTGGAAAAACTGGCGAAAGACGAAGCGGAAAAATATGCGACATTCTGGAAAGAATTCGGTTTAGTGCTGAAAGAAGGCGTGGGT
GAAGATTTTGCCAACCGCGAACAAATCGCCAAACTATTCCGTTTTGCTTCCACTCACACGGACAGCAGCGAACAAAGCGTATCGCTGGCG
GATTATATCGCCCGCATGAAAGAAGGACAAAAAGCCGTTTACTATATTACCGCCGACAGTTACGTCGCGGCGAAAAACAGTCCGCATTTG
GAATTGTTCAATAAAAAAGGCATTGAAGTGTTGCTGTTGTCCGATCGAATCGACGAATGGATGTTGAGCTATTTAACGGAATTTGACGGC
AAGCCGTTACAATCCATCACCAAAGCGGATTTGGATTTAGGCGATTTGGCGGATAAAACCGAAGCGGAAAAAGAGAAGGCGCAGGACGAA
GCTTTAAGCGGTTTCATCGAACGGGTGAAAACCCTGCTGGGCGAACGGGTAAAAGATGTGCGTTTGACCCATCGTTTAACCGATACGCCG
GCGGTGGTATCGACGGATAACGATCAAATGACTACTCAAATGGCGAAATTGTTCGCGATGAGCGGTCAGCCGGTGCCGGAGGTGAAATAT
ACTTTTGAATTGAATCCGGATCACGCTTTAGTGAAAAAAACGGCGGCATTGACCGATGAATCCGCTTTCGCCGACTGGGTGGAATTGCTG
TTGGAGCAAGCCATGTTGTCGGAGCGCGGCACCTTGGAAAATCCGACGGCTTTCATTAAACGCGTGAATACCTTGCTTGCAGGCTAG

Gene Information
Molecule Type genomic DNA
Bases 1887 Bases
Molecular Weight585663.22 Da
Coding Sequence CP000746.1:898164..900050
NCBI ReferenceABR74209
NotesPFAM: heat shock protein Hsp90; ATP-binding region

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 4 to 218 215 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 232 to 489 258 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 514 to 628 115 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_ACSU1

Accession Number

HSP90_0006

Added on

2012-02-02

Updated On

2014-01-20