Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Actinobacillus pleuropneumoniae serotype 5b (str. L20)

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_ACTP2, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

APL_0987

Gene Identifier

4848844

Taxon Information

Organism

Actinobacillus pleuropneumoniae serotype 5b (str. L20)

Organism ID

416269 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus pleuropneumoniae serovar 5b str. L20

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MSTNQETRGFQSEVKQLLQLMIHSLYSNKEIFLRELISNASDAADKLRFKALSNPALYEGDGELRVRVSF DETLGTLTISDNGIGMNREQVIDHLGTIAKSGTKEFLNSLGTDQAKDSQLIGQFGVGFYSAFIVADKVTV KTRAAGETQAVLWESAGEGDYTVADIEKATRGTDVILHLREEEKEFLSEWRLREIIGKYSDHIGLPVEIQ TTEYNEEGKASGQKWEKINKAQALWTRSKNEISDEEYQEFYKHLSHDYNDSLIWAHNKVEGKQEYTSLLY VPAKAPWDLFNRDQKHGLKLYVQRVFIMDDAEVFMPNYLRFMRGLLDTNDLPLNVSREILQENKITASLR AALTKRALQLLEKLAKDDQAKYQTFWNEFGLVLKEGVGEDFANKQQIASLFRFASTQTDSSEQTVSLADY VGRMKEGQKAIYFLTADSYVAAKNSPHLELFNKKGIEVLLLSDRIDEWVVGHLTEFDGKPLQSITKSDLD LGDLADKEQEESQKAQQAEFGSFLERAQSYFGERVKKVVLTHRLTDTPAVVSTDNDEMTTQMAKLFAAMG QKAPEVKYTFELNPDHRMVKKIADLTDETKFNDWIELLFEQALLAERGSLENPAAFIKRMNKLLG

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGTACTAATCAAGAAACAAGAGGCTTTCAATCGGAAGTTAAGCAACTGCTTCAATTAATGATCCATTCACTTTATTCAAATAAAGA
AATTTTCTTACGTGAATTAATCTCTAATGCGTCTGATGCGGCGGATAAACTACGCTTTAAAGCACTTTCAAATCCTGCGTTATATGAAGG
AGACGGCGAATTACGTGTACGAGTGAGCTTTGATGAAACTTTAGGTACATTAACGATCAGCGATAACGGTATCGGAATGAATCGTGAGCA
AGTGATCGATCACTTAGGTACGATTGCTAAATCAGGTACCAAAGAATTTTTAAATTCGTTAGGTACGGATCAAGCGAAAGACAGCCAATT
AATCGGTCAATTCGGGGTTGGTTTTTATTCGGCATTTATTGTAGCGGACAAAGTGACAGTGAAAACCCGTGCGGCGGGCGAAACACAAGC
CGTACTTTGGGAATCTGCCGGTGAAGGCGATTACACCGTAGCGGATATTGAGAAAGCGACACGCGGTACGGATGTTATTTTACATTTGCG
TGAAGAAGAAAAAGAATTTTTAAGCGAATGGCGTTTACGTGAAATTATCGGTAAATATTCGGATCATATCGGTTTACCAGTTGAAATCCA
AACTACCGAATACAATGAAGAAGGCAAAGCAAGCGGTCAAAAATGGGAAAAAATTAACAAAGCGCAAGCACTTTGGACTCGTTCAAAAAA
CGAAATTTCAGACGAAGAATACCAAGAGTTTTATAAACATTTAAGCCACGATTATAATGACTCGCTCATCTGGGCGCATAATAAAGTAGA
AGGTAAACAAGAATATACCAGCTTACTTTATGTGCCGGCAAAAGCACCTTGGGATTTGTTCAATCGTGATCAAAAACACGGCTTAAAACT
TTATGTACAGCGTGTATTTATTATGGACGATGCTGAAGTGTTTATGCCGAATTACCTACGTTTTATGCGAGGTTTATTAGACACGAATGA
CCTGCCGCTCAACGTTTCACGTGAGATTTTACAAGAAAATAAAATCACCGCTTCACTACGTGCGGCATTAACTAAACGTGCATTGCAATT
ATTGGAAAAATTAGCGAAGGACGATCAAGCTAAATACCAAACTTTCTGGAATGAATTCGGTTTAGTGTTAAAAGAAGGTGTAGGCGAAGA
TTTTGCCAATAAACAACAAATTGCGTCATTATTCCGCTTTGCTTCAACCCAAACTGATTCTAGCGAACAAACGGTAAGCTTGGCGGATTA
TGTTGGCAGAATGAAAGAAGGGCAGAAAGCAATTTATTTCTTAACTGCTGATAGCTATGTAGCAGCAAAAAATAGTCCGCACCTTGAACT
GTTCAATAAGAAAGGCATTGAAGTGCTGTTATTATCTGATCGTATTGACGAATGGGTAGTGGGGCACTTAACCGAATTTGACGGTAAACC
GTTGCAAAGTATCACTAAATCGGATTTGGATTTAGGCGATCTTGCCGATAAGGAACAAGAAGAGAGCCAAAAAGCGCAACAAGCGGAATT
CGGATCTTTCCTTGAGCGTGCGCAAAGCTATTTTGGTGAGCGTGTGAAAAAAGTGGTATTAACGCATCGCTTAACCGACACGCCGGCAGT
GGTTTCTACCGACAATGATGAAATGACGACACAGATGGCAAAACTGTTTGCCGCTATGGGACAAAAAGCACCGGAAGTGAAATATACGTT
TGAGCTAAATCCGGATCATCGTATGGTTAAGAAAATTGCAGATCTTACCGATGAAACGAAATTCAATGATTGGATTGAATTATTATTTGA
ACAAGCATTACTTGCAGAACGCGGTTCATTAGAAAATCCGGCAGCATTTATTAAACGTATGAATAAATTGCTTGGTTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine63434 %
Guanine41923 %
Thyamine49927 %
Cytosine32618 %
A+T113361 %
G+C74540 %

Total Bases :   1878 bases

Microsatellites
SequencePosition LengthRepeats
GAAGAAGAA54033
AAAAAA67623
AAAAAA71323
AAAAAA132523
AGAGAG149923
AAAAAA157523
ATTATTATT178733

Microsatellite Map

ATGAGTACTAATCAAGAAACAAGAGGCTTTCAATCGGAAGTTAAGCAACTGCTTCAATTAATGATCCATTCACTTTATTCAAATAAAGAA
ATTTTCTTACGTGAATTAATCTCTAATGCGTCTGATGCGGCGGATAAACTACGCTTTAAAGCACTTTCAAATCCTGCGTTATATGAAGGA
GACGGCGAATTACGTGTACGAGTGAGCTTTGATGAAACTTTAGGTACATTAACGATCAGCGATAACGGTATCGGAATGAATCGTGAGCAA
GTGATCGATCACTTAGGTACGATTGCTAAATCAGGTACCAAAGAATTTTTAAATTCGTTAGGTACGGATCAAGCGAAAGACAGCCAATTA
ATCGGTCAATTCGGGGTTGGTTTTTATTCGGCATTTATTGTAGCGGACAAAGTGACAGTGAAAACCCGTGCGGCGGGCGAAACACAAGCC
GTACTTTGGGAATCTGCCGGTGAAGGCGATTACACCGTAGCGGATATTGAGAAAGCGACACGCGGTACGGATGTTATTTTACATTTGCGT
GAAGAAGAAAAAGAATTTTTAAGCGAATGGCGTTTACGTGAAATTATCGGTAAATATTCGGATCATATCGGTTTACCAGTTGAAATCCAA
ACTACCGAATACAATGAAGAAGGCAAAGCAAGCGGTCAAAAATGGGAAAAAATTAACAAAGCGCAAGCACTTTGGACTCGTTCAAAAAAC
GAAATTTCAGACGAAGAATACCAAGAGTTTTATAAACATTTAAGCCACGATTATAATGACTCGCTCATCTGGGCGCATAATAAAGTAGAA
GGTAAACAAGAATATACCAGCTTACTTTATGTGCCGGCAAAAGCACCTTGGGATTTGTTCAATCGTGATCAAAAACACGGCTTAAAACTT
TATGTACAGCGTGTATTTATTATGGACGATGCTGAAGTGTTTATGCCGAATTACCTACGTTTTATGCGAGGTTTATTAGACACGAATGAC
CTGCCGCTCAACGTTTCACGTGAGATTTTACAAGAAAATAAAATCACCGCTTCACTACGTGCGGCATTAACTAAACGTGCATTGCAATTA
TTGGAAAAATTAGCGAAGGACGATCAAGCTAAATACCAAACTTTCTGGAATGAATTCGGTTTAGTGTTAAAAGAAGGTGTAGGCGAAGAT
TTTGCCAATAAACAACAAATTGCGTCATTATTCCGCTTTGCTTCAACCCAAACTGATTCTAGCGAACAAACGGTAAGCTTGGCGGATTAT
GTTGGCAGAATGAAAGAAGGGCAGAAAGCAATTTATTTCTTAACTGCTGATAGCTATGTAGCAGCAAAAAATAGTCCGCACCTTGAACTG
TTCAATAAGAAAGGCATTGAAGTGCTGTTATTATCTGATCGTATTGACGAATGGGTAGTGGGGCACTTAACCGAATTTGACGGTAAACCG
TTGCAAAGTATCACTAAATCGGATTTGGATTTAGGCGATCTTGCCGATAAGGAACAAGAAGAGAGCCAAAAAGCGCAACAAGCGGAATTC
GGATCTTTCCTTGAGCGTGCGCAAAGCTATTTTGGTGAGCGTGTGAAAAAAGTGGTATTAACGCATCGCTTAACCGACACGCCGGCAGTG
GTTTCTACCGACAATGATGAAATGACGACACAGATGGCAAAACTGTTTGCCGCTATGGGACAAAAAGCACCGGAAGTGAAATATACGTTT
GAGCTAAATCCGGATCATCGTATGGTTAAGAAAATTGCAGATCTTACCGATGAAACGAAATTCAATGATTGGATTGAATTATTATTTGAA
CAAGCATTACTTGCAGAACGCGGTTCATTAGAAAATCCGGCAGCATTTATTAAACGTATGAATAAATTGCTTGGTTAA

Gene Information
Molecule Type genomic DNA
Bases 1878 Bases
Molecular Weight582520.65 Da
Coding Sequence complement(CP000569.1:1139729..1141606)
NCBI ReferenceABN74081
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 4 to 216 213 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 230 to 487 258 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 512 to 624 113 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_ACPL1

Accession Number

HSP90_0005

Added on

2012-02-02

Updated On

2014-01-20