Help  Custom Search
 
Chaperone protein htpG. of Acinetobacter baumannii str. AB0057

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein htpG.

Synonymous Names

B7I369_ACIB5, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Taxon Information

Organism

Acinetobacter baumannii str. AB0057

Organism ID

480119 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter baumannii AB0057

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MSEQASQNYSFQAEVAQLLHLVTHSLYSNPEIFLRELISNASDACDKLRFEGINHPEYYENDPNLHVRIS LNKEDKTLTISDNGIGLSQQEAIDNLGTIAKSGTKDFMAKLTGDQKADAQLIGQFGVGFYSGFIVADKIT VESRRAGLDASEGVRWISGGTGEFEVQQIDKASRGTDIILHLRDDALDYLESYKVKQIVNKYSDHISLPI EMQKEVWQEEEVAEGEEPKGGQMVKTDEWEAINSASALWTRNKSEVTEEQYVEFYKNLTHDFEAPLAWAH NRVEGSTEYTQLLYIPSKAPHDIFTREAKAGIKLYVKRVFIMDDADNLIPNYLRFVQGVVDSADLPLNVS RELLQESRDVKTIREGNARRVLTLLDGLAKSEDEKDQEKFKTFYTEFGSVLKEGLGEDFGNRERILKLLR YATSTNDEVTTSFADYKARMKEGQKAIYYVTAESLAAAKNSPQLELFKKKGIEVLLMAERVDEWAMNFVH EFDGTPLKNVSKGAVDLGDLQDAEEKKALEQAAEQFKPVVEKLSDSLKAKTKEVRVTTRLVDSPACLVTS EGELSPQLIRMLKQAGQAVPEIKPILEINPEHPLVKKLEGSEQFDDLANVIFDQAVIAEGGLPEDPAAYV KRINSLLLK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGTGAACAAGCATCACAAAATTATAGTTTCCAAGCGGAAGTAGCACAGCTTTTACATTTAGTGACGCATTCTCTCTATTCAAACCC
TGAAATTTTCTTACGTGAACTTATCTCTAATGCATCAGATGCTTGTGATAAATTGCGTTTCGAAGGAATTAATCATCCTGAATATTATGA
AAATGACCCTAATTTACATGTACGAATCAGCTTAAATAAAGAAGATAAAACTTTAACGATTTCTGATAACGGTATTGGTTTAAGCCAACA
AGAAGCCATTGATAACTTGGGTACAATTGCAAAATCAGGTACTAAAGATTTCATGGCAAAATTGACGGGTGACCAGAAAGCGGATGCTCA
GTTAATTGGTCAGTTTGGTGTTGGTTTCTACTCAGGTTTTATTGTTGCCGATAAAATTACGGTTGAATCACGCCGCGCAGGTCTAGATGC
TTCTGAAGGGGTGCGTTGGATTAGTGGTGGTACAGGTGAGTTTGAAGTTCAGCAAATTGATAAAGCTTCACGCGGTACTGACATTATTCT
TCACTTGCGTGATGACGCGCTTGATTATTTAGAGTCTTATAAAGTTAAGCAAATCGTTAATAAATATTCTGACCACATTAGCTTGCCAAT
TGAAATGCAAAAAGAAGTTTGGCAAGAAGAAGAGGTTGCTGAAGGTGAGGAGCCTAAAGGCGGCCAAATGGTCAAAACAGATGAGTGGGA
AGCAATTAACTCGGCAAGTGCCCTATGGACACGTAACAAGAGTGAAGTGACTGAAGAGCAATATGTTGAGTTCTATAAAAACTTAACTCA
CGATTTTGAAGCTCCGCTTGCATGGGCACATAACCGTGTAGAAGGTAGTACGGAATATACCCAGTTACTTTATATTCCAAGTAAAGCACC
TCATGACATTTTTACACGTGAAGCAAAAGCAGGAATTAAGCTGTATGTAAAACGCGTATTTATTATGGATGATGCGGACAATCTAATTCC
AAACTATTTACGCTTTGTACAAGGTGTCGTGGACAGCGCTGATTTACCGCTTAATGTCAGCCGTGAGTTGTTGCAAGAAAGCCGTGATGT
TAAGACAATCCGTGAAGGTAACGCACGCCGTGTACTCACTTTGCTTGATGGCTTAGCTAAATCTGAAGATGAGAAAGACCAAGAAAAATT
CAAAACGTTCTACACTGAGTTTGGCTCAGTTCTTAAAGAAGGTTTGGGTGAAGACTTCGGTAACCGCGAACGTATTTTAAAATTATTACG
TTATGCAACTTCAACAAATGATGAGGTAACAACTTCTTTTGCGGACTATAAGGCACGCATGAAAGAAGGCCAAAAAGCTATCTATTATGT
GACTGCTGAAAGTTTAGCTGCTGCTAAGAACTCTCCACAGTTGGAGTTGTTTAAGAAAAAAGGCATTGAAGTATTATTAATGGCAGAGCG
TGTTGACGAGTGGGCAATGAACTTTGTTCACGAGTTTGACGGTACGCCATTGAAGAATGTATCTAAAGGTGCAGTTGATTTAGGCGACTT
GCAAGATGCTGAAGAGAAAAAGGCACTTGAGCAAGCGGCTGAACAGTTTAAACCTGTTGTTGAGAAATTAAGTGATTCATTGAAGGCTAA
AACCAAAGAAGTCCGTGTAACGACTCGTTTGGTAGATTCTCCGGCATGTTTAGTGACTAGTGAAGGGGAATTGTCTCCTCAACTTATTCG
TATGCTCAAACAAGCGGGGCAAGCCGTACCTGAAATCAAGCCAATTTTAGAAATTAATCCTGAGCATCCTTTAGTGAAAAAACTTGAAGG
TTCAGAACAATTTGATGATTTGGCGAATGTGATTTTTGATCAGGCGGTGATTGCAGAAGGTGGATTACCGGAAGATCCGGCAGCTTATGT
GAAGCGCATTAATAGCTTGTTGCTAAAATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine61332 %
Guanine44424 %
Thyamine54329 %
Cytosine32017 %
A+T115661 %
G+C76440 %

Total Bases :   1920 bases

Microsatellites
SequencePosition LengthRepeats
TCTCTC7223
AAGAAGAAG65233
GCTGCTGCT136533
AAAAAA140423
AAAAAA178523

Microsatellite Map

ATGAGTGAACAAGCATCACAAAATTATAGTTTCCAAGCGGAAGTAGCACAGCTTTTACATTTAGTGACGCATTCTCTCTATTCAAACCCT
GAAATTTTCTTACGTGAACTTATCTCTAATGCATCAGATGCTTGTGATAAATTGCGTTTCGAAGGAATTAATCATCCTGAATATTATGAA
AATGACCCTAATTTACATGTACGAATCAGCTTAAATAAAGAAGATAAAACTTTAACGATTTCTGATAACGGTATTGGTTTAAGCCAACAA
GAAGCCATTGATAACTTGGGTACAATTGCAAAATCAGGTACTAAAGATTTCATGGCAAAATTGACGGGTGACCAGAAAGCGGATGCTCAG
TTAATTGGTCAGTTTGGTGTTGGTTTCTACTCAGGTTTTATTGTTGCCGATAAAATTACGGTTGAATCACGCCGCGCAGGTCTAGATGCT
TCTGAAGGGGTGCGTTGGATTAGTGGTGGTACAGGTGAGTTTGAAGTTCAGCAAATTGATAAAGCTTCACGCGGTACTGACATTATTCTT
CACTTGCGTGATGACGCGCTTGATTATTTAGAGTCTTATAAAGTTAAGCAAATCGTTAATAAATATTCTGACCACATTAGCTTGCCAATT
GAAATGCAAAAAGAAGTTTGGCAAGAAGAAGAGGTTGCTGAAGGTGAGGAGCCTAAAGGCGGCCAAATGGTCAAAACAGATGAGTGGGAA
GCAATTAACTCGGCAAGTGCCCTATGGACACGTAACAAGAGTGAAGTGACTGAAGAGCAATATGTTGAGTTCTATAAAAACTTAACTCAC
GATTTTGAAGCTCCGCTTGCATGGGCACATAACCGTGTAGAAGGTAGTACGGAATATACCCAGTTACTTTATATTCCAAGTAAAGCACCT
CATGACATTTTTACACGTGAAGCAAAAGCAGGAATTAAGCTGTATGTAAAACGCGTATTTATTATGGATGATGCGGACAATCTAATTCCA
AACTATTTACGCTTTGTACAAGGTGTCGTGGACAGCGCTGATTTACCGCTTAATGTCAGCCGTGAGTTGTTGCAAGAAAGCCGTGATGTT
AAGACAATCCGTGAAGGTAACGCACGCCGTGTACTCACTTTGCTTGATGGCTTAGCTAAATCTGAAGATGAGAAAGACCAAGAAAAATTC
AAAACGTTCTACACTGAGTTTGGCTCAGTTCTTAAAGAAGGTTTGGGTGAAGACTTCGGTAACCGCGAACGTATTTTAAAATTATTACGT
TATGCAACTTCAACAAATGATGAGGTAACAACTTCTTTTGCGGACTATAAGGCACGCATGAAAGAAGGCCAAAAAGCTATCTATTATGTG
ACTGCTGAAAGTTTAGCTGCTGCTAAGAACTCTCCACAGTTGGAGTTGTTTAAGAAAAAAGGCATTGAAGTATTATTAATGGCAGAGCGT
GTTGACGAGTGGGCAATGAACTTTGTTCACGAGTTTGACGGTACGCCATTGAAGAATGTATCTAAAGGTGCAGTTGATTTAGGCGACTTG
CAAGATGCTGAAGAGAAAAAGGCACTTGAGCAAGCGGCTGAACAGTTTAAACCTGTTGTTGAGAAATTAAGTGATTCATTGAAGGCTAAA
ACCAAAGAAGTCCGTGTAACGACTCGTTTGGTAGATTCTCCGGCATGTTTAGTGACTAGTGAAGGGGAATTGTCTCCTCAACTTATTCGT
ATGCTCAAACAAGCGGGGCAAGCCGTACCTGAAATCAAGCCAATTTTAGAAATTAATCCTGAGCATCCTTTAGTGAAAAAACTTGAAGGT
TCAGAACAATTTGATGATTTGGCGAATGTGATTTTTGATCAGGCGGTGATTGCAGAAGGTGGATTACCGGAAGATCCGGCAGCTTATGTG
AAGCGCATTAATAGCTTGTTGCTAAAATAA

Gene Information
Molecule Type genomic DNA
Bases 1920 Bases
Molecular Weight595823.21 Da
Coding Sequence CP001182.1:402729..404648
NCBI ReferenceACJ39804
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 5 to 219 215 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 244 to 503 260 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 528 to 639 112 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_ACBA1

Accession Number

HSP90_0004

Added on

2012-02-02

Updated On

2014-01-20