Help  Custom Search
 
Heat shock protein 90, Chaperone protein htpG. of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Chaperone protein htpG.

Synonymous Names

HTPG_ACIF5, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Gene names

Gene Name

htpG

Gene Locus Tag

Lferr_2755

Gene Identifier

6878759

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MAASKETMQFQTEINQLLQLMIHSLYSNKEIFLRELISNASDACDKLRFEALADPALLTGDSELKVEVDF DPEAGTITVRDNGIGMNRDEVIANIGTIAKSGTREFFERLSGDQTKDAKLIGQFGVGFYSAFIVADRVSL NTRRAGMEAEHGVRWESDGTGTYTLETLDLPARGTEIVLHLREEERQDLLSAWRLRSIINKYSDHIPLSI RMRKIGEGGKPGDEWETVNKASALWQRSKSEISDDEYKEFYRYVSHDYGDPLTWSHNHVEGRLEYTSLLF IPAKAPFDLWDHNHPHGIKLYVQRVFIMDDAEQLLPRYLRFVRGVIDSSDLPLNVSREILQGNRVIDQMR SGSVKRILGLLEEMAEKEPEKYQTFWNEFGRVLKEGPGEDYSNREQIARLLRFASTHTDTDTQNVSLADY LARMAEGQDKIYYITADSFLAAKNSPQLELLRKKGIEVLLLSDRVDEWLTSHLPEFEGKALTSVAKGALD LGAIETEEERKSQEETEKDAEGLVERIKNALGERVETVRVSHRLTSSPACIVLGERDMALYMQQLLKQAG HEISSTKPVLEINPTHPMLARIEGEKDDTRFAEWSALLLDQAILAEGGQLEDPAGFVARINQLMLALAG

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCCGCCAGCAAGGAAACCATGCAATTTCAAACCGAGATCAATCAGCTATTGCAGTTGATGATCCATTCGCTTTACTCCAACAAAGA
GATCTTCCTGCGCGAGTTGATCTCCAATGCCTCCGACGCCTGCGACAAGCTACGTTTCGAGGCATTGGCCGACCCTGCCCTCTTGACAGG
TGACAGCGAGCTCAAGGTAGAGGTGGATTTCGATCCCGAGGCCGGCACCATTACCGTGCGAGACAACGGTATTGGCATGAACCGCGACGA
GGTGATCGCCAATATCGGCACTATCGCCAAATCCGGAACGCGAGAATTCTTTGAACGCCTCAGCGGCGATCAGACCAAAGACGCCAAGCT
GATCGGCCAGTTCGGAGTAGGTTTTTATTCGGCATTCATCGTTGCAGATCGCGTCAGCCTGAATACTCGTCGCGCCGGCATGGAGGCCGA
GCATGGTGTTCGCTGGGAGTCGGACGGTACCGGAACCTACACCCTGGAAACCCTGGATCTGCCCGCGCGCGGTACCGAAATCGTCTTGCA
CCTGCGCGAGGAAGAACGCCAGGACCTGCTCAGCGCATGGCGCTTACGCAGCATCATCAACAAGTATTCGGATCACATACCCCTGTCGAT
CCGTATGCGCAAAATAGGCGAAGGCGGCAAACCTGGTGACGAATGGGAAACGGTCAATAAGGCCTCCGCTCTCTGGCAACGATCCAAGTC
CGAGATCAGCGACGACGAGTACAAGGAGTTTTATCGCTATGTCAGCCACGACTATGGTGACCCTCTGACCTGGAGCCACAACCATGTTGA
AGGACGACTGGAATACACCTCCTTACTCTTCATTCCTGCCAAAGCACCCTTTGATCTCTGGGATCACAACCATCCCCACGGTATCAAGCT
CTATGTGCAGCGCGTCTTCATCATGGACGATGCCGAGCAGCTCCTTCCCCGCTATCTGCGCTTTGTGCGCGGTGTGATCGATTCCAGCGA
TTTGCCTCTTAACGTCTCCCGCGAGATTCTGCAAGGTAACCGAGTCATTGATCAGATGCGCTCCGGTTCGGTGAAACGAATACTGGGTCT
CCTCGAGGAAATGGCCGAGAAAGAGCCAGAAAAATATCAGACGTTTTGGAATGAGTTCGGACGGGTACTCAAGGAAGGACCGGGCGAGGA
TTACAGCAACCGCGAACAGATCGCCAGGCTGCTACGCTTCGCCAGCACCCACACGGATACGGACACGCAAAATGTATCGCTGGCCGATTA
CCTCGCGCGTATGGCCGAGGGTCAAGATAAAATCTACTACATCACTGCGGACTCCTTCCTTGCCGCCAAGAACAGCCCACAGTTGGAGTT
GCTGCGCAAAAAAGGCATCGAAGTATTGCTGCTCAGTGATCGCGTCGATGAATGGCTGACCAGCCATCTGCCCGAATTTGAGGGTAAGGC
ACTGACATCCGTCGCCAAGGGTGCACTTGACCTGGGCGCCATCGAAACCGAAGAAGAACGCAAATCGCAGGAAGAAACCGAAAAGGATGC
TGAGGGTTTGGTGGAACGCATCAAAAACGCCTTAGGCGAGCGGGTGGAGACGGTGCGCGTATCCCATCGTCTGACCAGTTCTCCGGCCTG
TATCGTCCTGGGTGAGCGGGACATGGCCCTGTACATGCAGCAATTGCTCAAGCAGGCCGGCCACGAAATATCCAGCACCAAACCTGTCCT
GGAGATCAACCCCACCCATCCCATGCTGGCACGCATAGAAGGCGAAAAAGACGATACCCGCTTCGCCGAATGGTCAGCACTGCTGCTGGA
TCAAGCGATTCTGGCCGAGGGGGGGCAATTAGAAGATCCCGCCGGCTTCGTCGCCCGCATCAATCAGTTGATGCTTGCGCTGGCAGGCTG
A 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine46725 %
Guanine51128 %
Thyamine37420 %
Cytosine53829 %
A+T84145 %
G+C104956 %

Total Bases :   1890 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCGCG51224
CTCTCT69723
CGACGACGA72833
CGCGCG126223
AAAAAA135623
GAAGAAGAA148833
CTGCTGCTG178833
GGGGGG181723

Microsatellite Map

ATGGCCGCCAGCAAGGAAACCATGCAATTTCAAACCGAGATCAATCAGCTATTGCAGTTGATGATCCATTCGCTTTACTCCAACAAAGAG
ATCTTCCTGCGCGAGTTGATCTCCAATGCCTCCGACGCCTGCGACAAGCTACGTTTCGAGGCATTGGCCGACCCTGCCCTCTTGACAGGT
GACAGCGAGCTCAAGGTAGAGGTGGATTTCGATCCCGAGGCCGGCACCATTACCGTGCGAGACAACGGTATTGGCATGAACCGCGACGAG
GTGATCGCCAATATCGGCACTATCGCCAAATCCGGAACGCGAGAATTCTTTGAACGCCTCAGCGGCGATCAGACCAAAGACGCCAAGCTG
ATCGGCCAGTTCGGAGTAGGTTTTTATTCGGCATTCATCGTTGCAGATCGCGTCAGCCTGAATACTCGTCGCGCCGGCATGGAGGCCGAG
CATGGTGTTCGCTGGGAGTCGGACGGTACCGGAACCTACACCCTGGAAACCCTGGATCTGCCCGCGCGCGGTACCGAAATCGTCTTGCAC
CTGCGCGAGGAAGAACGCCAGGACCTGCTCAGCGCATGGCGCTTACGCAGCATCATCAACAAGTATTCGGATCACATACCCCTGTCGATC
CGTATGCGCAAAATAGGCGAAGGCGGCAAACCTGGTGACGAATGGGAAACGGTCAATAAGGCCTCCGCTCTCTGGCAACGATCCAAGTCC
GAGATCAGCGACGACGAGTACAAGGAGTTTTATCGCTATGTCAGCCACGACTATGGTGACCCTCTGACCTGGAGCCACAACCATGTTGAA
GGACGACTGGAATACACCTCCTTACTCTTCATTCCTGCCAAAGCACCCTTTGATCTCTGGGATCACAACCATCCCCACGGTATCAAGCTC
TATGTGCAGCGCGTCTTCATCATGGACGATGCCGAGCAGCTCCTTCCCCGCTATCTGCGCTTTGTGCGCGGTGTGATCGATTCCAGCGAT
TTGCCTCTTAACGTCTCCCGCGAGATTCTGCAAGGTAACCGAGTCATTGATCAGATGCGCTCCGGTTCGGTGAAACGAATACTGGGTCTC
CTCGAGGAAATGGCCGAGAAAGAGCCAGAAAAATATCAGACGTTTTGGAATGAGTTCGGACGGGTACTCAAGGAAGGACCGGGCGAGGAT
TACAGCAACCGCGAACAGATCGCCAGGCTGCTACGCTTCGCCAGCACCCACACGGATACGGACACGCAAAATGTATCGCTGGCCGATTAC
CTCGCGCGTATGGCCGAGGGTCAAGATAAAATCTACTACATCACTGCGGACTCCTTCCTTGCCGCCAAGAACAGCCCACAGTTGGAGTTG
CTGCGCAAAAAAGGCATCGAAGTATTGCTGCTCAGTGATCGCGTCGATGAATGGCTGACCAGCCATCTGCCCGAATTTGAGGGTAAGGCA
CTGACATCCGTCGCCAAGGGTGCACTTGACCTGGGCGCCATCGAAACCGAAGAAGAACGCAAATCGCAGGAAGAAACCGAAAAGGATGCT
GAGGGTTTGGTGGAACGCATCAAAAACGCCTTAGGCGAGCGGGTGGAGACGGTGCGCGTATCCCATCGTCTGACCAGTTCTCCGGCCTGT
ATCGTCCTGGGTGAGCGGGACATGGCCCTGTACATGCAGCAATTGCTCAAGCAGGCCGGCCACGAAATATCCAGCACCAAACCTGTCCTG
GAGATCAACCCCACCCATCCCATGCTGGCACGCATAGAAGGCGAAAAAGACGATACCCGCTTCGCCGAATGGTCAGCACTGCTGCTGGAT
CAAGCGATTCTGGCCGAGGGGGGGCAATTAGAAGATCCCGCCGGCTTCGTCGCCCGCATCAATCAGTTGATGCTTGCGCTGGCAGGCTGA

Gene Information
Molecule Type genomic DNA
Bases 1890 Bases
Molecular Weight583783.06 Da
Coding Sequence complement(CP001132.1:2739618..2741507)
NCBI ReferenceACH84946
NotesPFAM: heat shock protein Hsp90; ATP-binding region

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 4 to 212 209 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 230 to 487 258 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 512 to 626 115 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_ACFE1

Accession Number

HSP90_0003

Added on

2012-02-02

Updated On

2014-01-20