Help  Custom Search
 
Heat shock protein 90. of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90.

Synonymous Names

A5G343_ACICJ, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MNTATATDRPFDAEVGRLLDLVVHSLYSEREIFLRELVANAADATDRRRFLALSDESLALPEGAAIRISI DKPARTITIADDGIGMTAEDLASHLGTIARSGTRAFTASLAEAKPEDRPNLIGQFGVGFYSAFMVADRVE VTSRRAGTDAAHKWSSEGTGGYRIEAATRETPGTDIVLHVKSDADEFLEPVRLETILRKWADHISVPVEI ERDGKFQKANEGTALWRRRKADIAEKDYTDFYRHLGHMFDEPWATIHWSAEGTVEFSALLFIPGRSPFPV TEDDRESHVRLHVKRMFITDDAKLLPTWLRFVEGVVDTEDLPLNVSREMLQSTPVLARIRKALVNRVLGE LKTRAKEAETYRGFIEQHGPMLKEGIYDDADHRNEIAALARFRSTHGEELTSLDDYVTRMQEGQKDIYYI TGEDPARLAASPQIEGLRAKGYEVLLLSDQIDFFWPERLGTYEGHKLVHVGQARDMFDVAETPEPLKALI DALKSALGEQVGEVRASTRLTDSPAALAAGEAQPDLALQRLLRRAGRPSFAPPPALELNPAHRLIEGLVS RAAAGEAMDDWAALLLDLARIQDGESPVDPARFARLVADRMAGNPA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAACACCGCAACCGCGACCGACCGTCCGTTCGACGCCGAAGTGGGCCGCCTGCTCGATCTGGTGGTTCATTCGCTCTACTCCGAACG
CGAGATCTTTCTCCGCGAACTCGTCGCCAACGCCGCCGACGCGACCGACCGGCGCCGCTTCCTCGCCCTGTCGGACGAGAGCCTGGCACT
GCCCGAGGGCGCTGCCATCCGCATCAGCATCGACAAGCCGGCGCGAACGATCACCATTGCCGATGACGGCATCGGCATGACGGCGGAAGA
CCTGGCGAGCCATCTCGGCACCATCGCCCGCTCCGGCACCAGGGCCTTCACCGCGTCCCTCGCCGAGGCCAAGCCCGAGGACCGGCCGAA
CCTGATCGGCCAGTTCGGCGTCGGCTTCTATTCCGCCTTCATGGTGGCCGACCGCGTCGAGGTGACCTCCCGCCGCGCCGGCACCGATGC
CGCGCACAAATGGTCCTCCGAGGGCACCGGCGGCTACCGCATCGAGGCCGCCACCCGCGAGACCCCGGGCACCGACATCGTGCTCCACGT
CAAGTCCGATGCCGACGAATTCCTCGAACCCGTCCGCCTCGAGACGATCCTGCGCAAATGGGCCGACCATATCTCCGTCCCGGTCGAGAT
CGAGCGCGACGGCAAGTTCCAGAAGGCGAACGAGGGCACCGCGCTCTGGCGCCGGCGCAAGGCCGACATCGCCGAGAAGGACTACACCGA
TTTCTACCGCCATCTCGGCCACATGTTCGACGAGCCCTGGGCGACGATCCACTGGAGTGCCGAGGGCACGGTCGAATTCTCCGCCCTGCT
CTTCATCCCCGGCCGCTCGCCCTTCCCGGTGACCGAGGACGACCGCGAATCCCATGTCCGCCTGCACGTGAAGCGGATGTTCATCACCGA
CGACGCGAAGCTCCTGCCCACCTGGCTGCGCTTCGTCGAGGGCGTGGTCGACACTGAGGATCTGCCGCTCAACGTCTCGCGCGAGATGCT
GCAATCCACCCCGGTCCTCGCCCGCATCCGCAAGGCACTGGTCAACCGTGTGCTGGGCGAGCTCAAGACCCGTGCGAAGGAGGCCGAGAC
CTATCGCGGCTTCATCGAGCAGCATGGCCCGATGCTGAAGGAAGGCATCTATGACGACGCCGACCACCGGAACGAAATCGCCGCCCTCGC
CCGCTTCCGCAGCACCCATGGCGAGGAGCTGACCTCGCTCGACGACTATGTCACGCGGATGCAGGAGGGGCAGAAGGACATCTACTACAT
CACCGGCGAGGATCCCGCGCGCCTCGCCGCCTCGCCGCAGATCGAGGGCTTGCGGGCGAAGGGCTACGAGGTGCTGCTGCTCTCCGACCA
GATCGATTTCTTCTGGCCCGAACGGCTCGGCACCTACGAGGGGCACAAGCTCGTCCATGTCGGCCAGGCACGCGACATGTTCGACGTCGC
GGAGACGCCGGAACCGCTGAAGGCGCTGATCGACGCGCTGAAATCCGCCCTCGGCGAGCAGGTCGGCGAGGTGCGCGCCTCGACCCGCCT
GACCGACAGTCCGGCAGCCCTCGCCGCCGGCGAGGCGCAGCCCGACCTCGCCCTGCAACGCCTGCTGCGCCGCGCCGGCCGTCCGAGCTT
CGCGCCGCCGCCGGCCCTCGAACTCAACCCCGCGCACCGGCTGATCGAGGGACTCGTCTCCCGCGCCGCCGCAGGCGAGGCGATGGACGA
CTGGGCCGCCCTGCTGCTCGACCTCGCCCGCATCCAGGATGGCGAATCCCCGGTCGATCCGGCCCGTTTCGCCCGCCTGGTGGCGGACAG
GATGGCCGGCAACCCCGCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine31118 %
Guanine55731 %
Thyamine26215 %
Cytosine69138 %
A+T57332 %
G+C124869 %

Total Bases :   1821 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG97623
CGCGCG127423
TGCTGCTGC133033
GCGCGC151123
CGCCGCCGC162133
CGCCGCCGC168233

Microsatellite Map

ATGAACACCGCAACCGCGACCGACCGTCCGTTCGACGCCGAAGTGGGCCGCCTGCTCGATCTGGTGGTTCATTCGCTCTACTCCGAACGC
GAGATCTTTCTCCGCGAACTCGTCGCCAACGCCGCCGACGCGACCGACCGGCGCCGCTTCCTCGCCCTGTCGGACGAGAGCCTGGCACTG
CCCGAGGGCGCTGCCATCCGCATCAGCATCGACAAGCCGGCGCGAACGATCACCATTGCCGATGACGGCATCGGCATGACGGCGGAAGAC
CTGGCGAGCCATCTCGGCACCATCGCCCGCTCCGGCACCAGGGCCTTCACCGCGTCCCTCGCCGAGGCCAAGCCCGAGGACCGGCCGAAC
CTGATCGGCCAGTTCGGCGTCGGCTTCTATTCCGCCTTCATGGTGGCCGACCGCGTCGAGGTGACCTCCCGCCGCGCCGGCACCGATGCC
GCGCACAAATGGTCCTCCGAGGGCACCGGCGGCTACCGCATCGAGGCCGCCACCCGCGAGACCCCGGGCACCGACATCGTGCTCCACGTC
AAGTCCGATGCCGACGAATTCCTCGAACCCGTCCGCCTCGAGACGATCCTGCGCAAATGGGCCGACCATATCTCCGTCCCGGTCGAGATC
GAGCGCGACGGCAAGTTCCAGAAGGCGAACGAGGGCACCGCGCTCTGGCGCCGGCGCAAGGCCGACATCGCCGAGAAGGACTACACCGAT
TTCTACCGCCATCTCGGCCACATGTTCGACGAGCCCTGGGCGACGATCCACTGGAGTGCCGAGGGCACGGTCGAATTCTCCGCCCTGCTC
TTCATCCCCGGCCGCTCGCCCTTCCCGGTGACCGAGGACGACCGCGAATCCCATGTCCGCCTGCACGTGAAGCGGATGTTCATCACCGAC
GACGCGAAGCTCCTGCCCACCTGGCTGCGCTTCGTCGAGGGCGTGGTCGACACTGAGGATCTGCCGCTCAACGTCTCGCGCGAGATGCTG
CAATCCACCCCGGTCCTCGCCCGCATCCGCAAGGCACTGGTCAACCGTGTGCTGGGCGAGCTCAAGACCCGTGCGAAGGAGGCCGAGACC
TATCGCGGCTTCATCGAGCAGCATGGCCCGATGCTGAAGGAAGGCATCTATGACGACGCCGACCACCGGAACGAAATCGCCGCCCTCGCC
CGCTTCCGCAGCACCCATGGCGAGGAGCTGACCTCGCTCGACGACTATGTCACGCGGATGCAGGAGGGGCAGAAGGACATCTACTACATC
ACCGGCGAGGATCCCGCGCGCCTCGCCGCCTCGCCGCAGATCGAGGGCTTGCGGGCGAAGGGCTACGAGGTGCTGCTGCTCTCCGACCAG
ATCGATTTCTTCTGGCCCGAACGGCTCGGCACCTACGAGGGGCACAAGCTCGTCCATGTCGGCCAGGCACGCGACATGTTCGACGTCGCG
GAGACGCCGGAACCGCTGAAGGCGCTGATCGACGCGCTGAAATCCGCCCTCGGCGAGCAGGTCGGCGAGGTGCGCGCCTCGACCCGCCTG
ACCGACAGTCCGGCAGCCCTCGCCGCCGGCGAGGCGCAGCCCGACCTCGCCCTGCAACGCCTGCTGCGCCGCGCCGGCCGTCCGAGCTTC
GCGCCGCCGCCGGCCCTCGAACTCAACCCCGCGCACCGGCTGATCGAGGGACTCGTCTCCCGCGCCGCCGCAGGCGAGGCGATGGACGAC
TGGGCCGCCCTGCTGCTCGACCTCGCCCGCATCCAGGATGGCGAATCCCCGGTCGATCCGGCCCGTTTCGCCCGCCTGGTGGCGGACAGG
ATGGCCGGCAACCCCGCCTGA

Gene Information
Molecule Type genomic DNA
Bases 1821 Bases
Molecular Weight560240.1 Da
Coding Sequence complement(CP000697.1:3369104..3370924)
NCBI ReferenceABQ32275
NotesPFAM: heat shock protein Hsp90; ATP-binding region;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 5 to 213 209 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 221 to 473 253 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 488 to 603 116 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_ACCR1

Accession Number

HSP90_0002

Added on

2012-02-02

Updated On

2014-01-20