Help  Custom Search
 
Heat shock protein 90, Heat shock protein HtpG. of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Heat shock protein 90, Heat shock protein HtpG.

Synonymous Names

B0C1N2_ACAM1, High temperature protein G, Heat shock protein C62.5, Chaperone protein htpG.

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp90 Protein family

Protein Type

htpG
(Bacterial Hsp90 Homolog)

SEQUENCE INFORMATION

Sequence
MTMLEQGTISIHTENIFPIIKKWLYSDHEIFLRELISNAVDAMQKMKMVSMAGEYSGEVGEPEVVITVDK DNKQLTITDNGIGMTADEVKQYITQVAFSSAEEFVEKYKDSGDQAIIGHFGLGFYSSFMVAQKVEIDTLS YKEGAEAVHWSCEGNTDYQLEASEWNQRGTKITLTLMEEEIEYAEEARIKSLVKTYCDFLPVPIKLGDEQ INKQKAPWKESPSNLTDEDYLEFYRYLYPFQEDPLLWVHLNTDYPFIVNGILYFPKLKPDIDVTKGQIKL FCNQVFVSDNCEEVIPQFLMPLQGVIDSSDIPLNVSRSFLQNDRTVRRIADYIAKKVGDRLKALYRDDRD AYIRCWQDVGTFVKFGSINNDKFKKQIEDILIYRTTAELAPAPEPTAEPAIENSEDTTDDAWADSPTDAK EEASAASSEPPHTTLKEYLERNQERHENQVYYCTDEVNQATYVSLLKNQGLEVLFLDTFIDTHFVPFLER EYTDVKFARVDADLDETLIDKDQAAEIVDPTTNQTRSEIIKALFEKSLDNSNLTIRTEALKSDTPQGAPP AMVLLPESARRMQEMMAMMQQQNMQFPTEYTLLVNTSHPLIQNLLTLSQGGVVQADGQSPAGELANQICH HVYDLALMAQKGFDAEGMQAFTERSNQVLTRLTELAAK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGACTATGCTGGAACAAGGCACAATTTCGATACATACCGAGAATATCTTCCCGATCATCAAAAAATGGCTCTATTCAGACCATGAGAT
TTTCTTGCGGGAACTGATTTCCAATGCAGTGGACGCCATGCAGAAAATGAAGATGGTGTCGATGGCAGGGGAATATTCCGGTGAAGTGGG
GGAACCTGAGGTTGTAATCACCGTTGACAAGGATAACAAGCAGCTCACCATTACCGACAATGGCATCGGCATGACAGCTGATGAGGTCAA
GCAATATATTACTCAGGTGGCCTTTTCCAGTGCAGAGGAATTTGTCGAGAAATATAAAGACAGTGGTGATCAGGCCATTATTGGCCATTT
TGGCTTGGGCTTTTATTCGTCCTTTATGGTGGCGCAAAAAGTTGAAATCGATACTCTGTCTTATAAAGAAGGGGCTGAAGCCGTTCATTG
GTCCTGCGAAGGCAATACGGACTATCAGTTAGAGGCCTCAGAGTGGAATCAGCGAGGGACTAAGATTACCCTCACTTTGATGGAAGAGGA
GATTGAATATGCCGAAGAGGCTCGCATCAAGTCTTTGGTAAAGACCTACTGTGATTTCCTGCCTGTCCCCATCAAATTAGGGGATGAGCA
AATTAACAAGCAAAAAGCACCTTGGAAAGAGTCTCCTAGCAATCTTACCGATGAAGACTATCTGGAGTTTTATCGGTATCTATATCCCTT
CCAGGAAGATCCTTTACTCTGGGTACATCTAAATACGGACTATCCGTTTATCGTCAATGGCATTCTCTACTTTCCGAAGCTGAAGCCAGA
TATTGATGTGACAAAAGGCCAAATAAAGCTGTTTTGCAATCAGGTATTTGTTAGCGACAATTGTGAAGAGGTGATTCCTCAGTTCCTGAT
GCCGCTCCAGGGCGTGATTGACAGTAGCGATATCCCTCTTAATGTCTCCCGTAGCTTTTTGCAGAATGATCGCACGGTCCGCCGGATTGC
GGATTATATTGCTAAGAAAGTGGGGGATCGCCTGAAAGCCCTCTATCGTGATGACCGGGATGCCTATATTCGCTGCTGGCAAGATGTGGG
GACTTTCGTCAAATTCGGCTCCATCAATAACGATAAGTTCAAGAAACAAATCGAAGATATTTTGATTTATCGAACCACTGCTGAACTTGC
TCCAGCCCCAGAGCCTACGGCTGAACCTGCCATTGAAAATTCTGAAGATACAACGGATGATGCTTGGGCAGATTCTCCAACTGATGCCAA
AGAAGAGGCTTCTGCTGCCTCCTCTGAACCGCCCCATACGACGTTGAAAGAGTATCTGGAGCGCAATCAGGAGCGGCATGAGAACCAGGT
TTACTACTGTACCGATGAGGTCAACCAAGCGACCTATGTCTCCTTACTGAAAAATCAAGGATTGGAAGTACTGTTCCTGGATACTTTTAT
TGACACCCACTTTGTCCCGTTCCTAGAACGAGAATATACAGACGTGAAGTTTGCACGGGTGGATGCGGATTTGGATGAAACCCTTATTGA
TAAGGATCAAGCAGCCGAAATTGTCGATCCCACTACCAATCAAACGCGCAGTGAAATTATCAAGGCCCTGTTTGAGAAATCTCTGGACAA
TTCTAATCTAACCATCCGCACCGAAGCGTTGAAGTCGGATACTCCTCAAGGGGCACCTCCGGCAATGGTGCTGTTACCGGAATCCGCTCG
TCGGATGCAGGAGATGATGGCCATGATGCAGCAACAGAATATGCAGTTTCCTACTGAATATACGTTGCTAGTCAATACCTCTCATCCACT
GATTCAAAATCTGTTGACTCTGAGTCAGGGAGGAGTGGTCCAAGCGGATGGTCAATCTCCTGCAGGAGAATTAGCAAATCAAATTTGCCA
CCATGTCTATGATTTGGCTCTGATGGCTCAGAAAGGGTTTGATGCTGAGGGAATGCAAGCATTTACCGAGCGCTCTAACCAGGTGCTCAC
TCGGTTGACTGAGTTAGCTGCGAAATAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine56329 %
Guanine48725 %
Thyamine51826 %
Cytosine43922 %
A+T108154 %
G+C92647 %

Total Bases :   2007 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA6023
ATATAT27223

Microsatellite Map

ATGACTATGCTGGAACAAGGCACAATTTCGATACATACCGAGAATATCTTCCCGATCATCAAAAAATGGCTCTATTCAGACCATGAGATT
TTCTTGCGGGAACTGATTTCCAATGCAGTGGACGCCATGCAGAAAATGAAGATGGTGTCGATGGCAGGGGAATATTCCGGTGAAGTGGGG
GAACCTGAGGTTGTAATCACCGTTGACAAGGATAACAAGCAGCTCACCATTACCGACAATGGCATCGGCATGACAGCTGATGAGGTCAAG
CAATATATTACTCAGGTGGCCTTTTCCAGTGCAGAGGAATTTGTCGAGAAATATAAAGACAGTGGTGATCAGGCCATTATTGGCCATTTT
GGCTTGGGCTTTTATTCGTCCTTTATGGTGGCGCAAAAAGTTGAAATCGATACTCTGTCTTATAAAGAAGGGGCTGAAGCCGTTCATTGG
TCCTGCGAAGGCAATACGGACTATCAGTTAGAGGCCTCAGAGTGGAATCAGCGAGGGACTAAGATTACCCTCACTTTGATGGAAGAGGAG
ATTGAATATGCCGAAGAGGCTCGCATCAAGTCTTTGGTAAAGACCTACTGTGATTTCCTGCCTGTCCCCATCAAATTAGGGGATGAGCAA
ATTAACAAGCAAAAAGCACCTTGGAAAGAGTCTCCTAGCAATCTTACCGATGAAGACTATCTGGAGTTTTATCGGTATCTATATCCCTTC
CAGGAAGATCCTTTACTCTGGGTACATCTAAATACGGACTATCCGTTTATCGTCAATGGCATTCTCTACTTTCCGAAGCTGAAGCCAGAT
ATTGATGTGACAAAAGGCCAAATAAAGCTGTTTTGCAATCAGGTATTTGTTAGCGACAATTGTGAAGAGGTGATTCCTCAGTTCCTGATG
CCGCTCCAGGGCGTGATTGACAGTAGCGATATCCCTCTTAATGTCTCCCGTAGCTTTTTGCAGAATGATCGCACGGTCCGCCGGATTGCG
GATTATATTGCTAAGAAAGTGGGGGATCGCCTGAAAGCCCTCTATCGTGATGACCGGGATGCCTATATTCGCTGCTGGCAAGATGTGGGG
ACTTTCGTCAAATTCGGCTCCATCAATAACGATAAGTTCAAGAAACAAATCGAAGATATTTTGATTTATCGAACCACTGCTGAACTTGCT
CCAGCCCCAGAGCCTACGGCTGAACCTGCCATTGAAAATTCTGAAGATACAACGGATGATGCTTGGGCAGATTCTCCAACTGATGCCAAA
GAAGAGGCTTCTGCTGCCTCCTCTGAACCGCCCCATACGACGTTGAAAGAGTATCTGGAGCGCAATCAGGAGCGGCATGAGAACCAGGTT
TACTACTGTACCGATGAGGTCAACCAAGCGACCTATGTCTCCTTACTGAAAAATCAAGGATTGGAAGTACTGTTCCTGGATACTTTTATT
GACACCCACTTTGTCCCGTTCCTAGAACGAGAATATACAGACGTGAAGTTTGCACGGGTGGATGCGGATTTGGATGAAACCCTTATTGAT
AAGGATCAAGCAGCCGAAATTGTCGATCCCACTACCAATCAAACGCGCAGTGAAATTATCAAGGCCCTGTTTGAGAAATCTCTGGACAAT
TCTAATCTAACCATCCGCACCGAAGCGTTGAAGTCGGATACTCCTCAAGGGGCACCTCCGGCAATGGTGCTGTTACCGGAATCCGCTCGT
CGGATGCAGGAGATGATGGCCATGATGCAGCAACAGAATATGCAGTTTCCTACTGAATATACGTTGCTAGTCAATACCTCTCATCCACTG
ATTCAAAATCTGTTGACTCTGAGTCAGGGAGGAGTGGTCCAAGCGGATGGTCAATCTCCTGCAGGAGAATTAGCAAATCAAATTTGCCAC
CATGTCTATGATTTGGCTCTGATGGCTCAGAAAGGGTTTGATGCTGAGGGAATGCAAGCATTTACCGAGCGCTCTAACCAGGTGCTCACT
CGGTTGACTGAGTTAGCTGCGAAATAG

Gene Information
Molecule Type genomic DNA
Bases 2007 Bases
Molecular Weight621126.16 Da
Coding Sequence CP000828.1:5994015..5996021
NCBI ReferenceABW30866
NotesHSP90 family

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N-terminal Domain 3 to 213 211 ATPase Domain of HSP90 chaperone IPR003594
SSF55874
Middle Domain 213 to 503 291 Client protein binding and Catalytic loop IPR020568
SSF54211
C-terminal Domain 525 to 661 137 C-terminal Domain of HSP90 SSF110942

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HTPG_ACMA1

Accession Number

HSP90_0001

Added on

2012-02-02

Updated On

2014-01-20