Help  Custom Search
 
heat shock cognate 71 kDa protein of Bos taurus

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock cognate 71 kDa protein

Synonymous Names

HSP7C_BOVIN, HSC70, Heat shock 70 kDa protein 8, Hsp70

Taxon Information

Organism

Bos taurus

Organism ID

9913 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos; Bos taurus

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDA KRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVT NAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAATIAYGLDKKVGAERNVLIFDLGGGTFDVSIL TIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQA SIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLL QDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQG KINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGMPGGFP GGGAPPSGGASSGPTIEEVD

FASTA Format Composition Secondary Structure

Nucleotide
 GGTCTCATTGGACGCACCGGCAGCATTCCAGGTTGCTGACTCTTTCAGCAGAGCCGGGCCTACGCTTTTGCAACCATGTCTAAAGGACC
TGCAGTTGGCATTGATCTTGGCACCACCTATTCTTGTGTGGGTGTCTTCCAGCACGGAAAGGTGGAAATAATTGCCAATGATCAGGGGAA
CCGAACCACCCCAAGCTATGTCGCCTTTACTGATACCGAACGGTTAATCGGTGATGCAGCAAAGAACCAAGTCGCAATGAATCCCACCAA
CACGGTTTTTGATGCCAAACGACTTATTGGACGAAGATTTGATGATGCTGTTGTCCAGTCTGATATGAAACATTGGCCCTTCATGGTGGT
GAATGATGCTGGCAGGCCTAAGGTTCAAGTAGAATACAAGGGAGAGACAAAGAGTTTTTACCCAGAGGAGGTGTCATCCATGGTCCTGAC
AAAGATGAAGGAAATCGCAGAAGCCTACCTTGGGAAGACGGTTACCAACGCTGTCGTCACAGTACCTGCCTATTTTAATGACTCTCAGCG
TCAGGCTACCAAAGATGCTGGAACTATTGCTGGTCTCAACGTACTTCGAATCATCAATGAGCCAACTGCTGCTACTATTGCCTATGGCTT
AGACAAAAAGGTTGGAGCAGAAAGAAACGTGCTGATCTTTGATTTAGGGGGTGGCACTTTTGATGTGTCAATCCTCACTATTGAGGATGG
AATCTTTGAGGTCAAATCTACAGCTGGAGATACTCACTTGGGTGGAGAAGACTTTGACAACCGCATGGTTAACCATTTTATTGCGGAGTT
CAAGCGTAAACACAAGAAGGATATCAGTGAAAACAAGAGGGCTGTCCGTCGCCTCCGTACTGCTTGTGAGCGTGCTAAGCGCACTCTCTC
TTCCAGCACCCAGGCCAGTATTGAGATTGATTCCCTCTATGAAGGAATCGACTTCTATACCTCTATTACCCGTGCCCGATTTGAAGAATT
GAATGCTGACTTGTTCCGTGGCACCCTGGACCCTGTGGAGAAAGCCCTTAGGGATGCCAAACTGGACAAGTCTCAGATTCATGATATTGT
CTTGGTTGGTGGCTCAACCCGTATCCCCAAGATTCAGAAACTTCTCCAGGACTTCTTCAACGGGAAAGAACTGAATAAGAGCATCAACCC
TGATGAGGCTGTTGCATATGGTGCAGCTGTCCAGGCAGCCATTTTGTCTGGAGACAAATCTGAAAATGTTCAAGACTTGCTGCTGTTGGA
TGTCACTCCTCTTTCCCTTGGAATTGAAACTGCTGGTGGAGTCATGACTGTCCTCATCAAGCGCAATACTACCATTCCTACCAAGCAGAC
GCAGACTTTCACCACCTACTCTGACAACCAGCCTGGTGTGCTCATTCAGGTTTATGAAGGTGAGCGTGCCATGACCAAGGATAACAACCT
GCTTGGCAAGTTTGAACTCACGGGCATACCTCCTGCCCCCCGTGGTGTTCCTCAGATTGAAGTCACTTTTGATATTGATGCCAATGGCAT
CCTCAATGTTTCTGCTGTGGATAAGAGCACAGGAAAAGAGAACAAGATTACCATCACTAATGACAAGGGCCGCTTGAGCAAGGAAGACAT
TGAACGCATGGTTCAAGAAGCAGAGAAGTACAAAGCTGAAGATGAGAAGCAGCGGGACAAGGTGTCTTCAAAGAATTCGCTTGAATCCTA
CGCCTTCAACATGAAAGCTACTGTTGAGGATGAGAAACTTCAGGGCAAGATTAATGATGAGGACAAACAGAAGATTCTTGACAAGTGTAA
TGAAATAATCAACTGGCTGGATAAGAACCAGACTGCAGAGAAGGAAGAATTTGAACATCAGCAGAAGGAGCTGGAAAAAGTCTGCAACCC
CATCATTACCAAGCTGTACCAGAGTGCAGGAGGCATGCCTGGGGGAATGCCAGGAGGAATGCCTGGGGGCTTCCCTGGTGGTGGAGCTCC
TCCATCAGGTGGTGCCTCCTCTGGGCCCACCATTGAAGAGGTTGATTAAGCCAGCCTAGCATAGATTTAGCATTGTTCCACACAAAACAT
GGAAGGACCCAAATTGTAGCAAATTCCGTGGCAGTTACGAAGTTGAGCTGCTATAGTAAATAAACTGGGCATTCTTGATACTTGAACATG
GAATGTGTGTGCACATGGAAAAACATTGCACTTTACAAGCACTGTATTGTAAGTGGAAAAATGCAATGTCTTAAATAAAATTGTATTTAA
AATTGCCAAAAAAAAAAAAAAAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine66230 %
Guanine55225 %
Thyamine55925 %
Cytosine49922 %
A+T122154 %
G+C105147 %

Total Bases :   2272 bases

Microsatellites
SequencePosition LengthRepeats
TGTGTG12323
GAGAGA40023
CTCTCTCT89224
CCCCCC147423
TGGTGGTGG196433
CACACA205723
TGTGTGTG216224
AAAAAAAAAAAAAAAA225628

Microsatellite Map

GGTCTCATTGGACGCACCGGCAGCATTCCAGGTTGCTGACTCTTTCAGCAGAGCCGGGCCTACGCTTTTGCAACCATGTCTAAAGGACCT
GCAGTTGGCATTGATCTTGGCACCACCTATTCTTGTGTGGGTGTCTTCCAGCACGGAAAGGTGGAAATAATTGCCAATGATCAGGGGAAC
CGAACCACCCCAAGCTATGTCGCCTTTACTGATACCGAACGGTTAATCGGTGATGCAGCAAAGAACCAAGTCGCAATGAATCCCACCAAC
ACGGTTTTTGATGCCAAACGACTTATTGGACGAAGATTTGATGATGCTGTTGTCCAGTCTGATATGAAACATTGGCCCTTCATGGTGGTG
AATGATGCTGGCAGGCCTAAGGTTCAAGTAGAATACAAGGGAGAGACAAAGAGTTTTTACCCAGAGGAGGTGTCATCCATGGTCCTGACA
AAGATGAAGGAAATCGCAGAAGCCTACCTTGGGAAGACGGTTACCAACGCTGTCGTCACAGTACCTGCCTATTTTAATGACTCTCAGCGT
CAGGCTACCAAAGATGCTGGAACTATTGCTGGTCTCAACGTACTTCGAATCATCAATGAGCCAACTGCTGCTACTATTGCCTATGGCTTA
GACAAAAAGGTTGGAGCAGAAAGAAACGTGCTGATCTTTGATTTAGGGGGTGGCACTTTTGATGTGTCAATCCTCACTATTGAGGATGGA
ATCTTTGAGGTCAAATCTACAGCTGGAGATACTCACTTGGGTGGAGAAGACTTTGACAACCGCATGGTTAACCATTTTATTGCGGAGTTC
AAGCGTAAACACAAGAAGGATATCAGTGAAAACAAGAGGGCTGTCCGTCGCCTCCGTACTGCTTGTGAGCGTGCTAAGCGCACTCTCTCT
TCCAGCACCCAGGCCAGTATTGAGATTGATTCCCTCTATGAAGGAATCGACTTCTATACCTCTATTACCCGTGCCCGATTTGAAGAATTG
AATGCTGACTTGTTCCGTGGCACCCTGGACCCTGTGGAGAAAGCCCTTAGGGATGCCAAACTGGACAAGTCTCAGATTCATGATATTGTC
TTGGTTGGTGGCTCAACCCGTATCCCCAAGATTCAGAAACTTCTCCAGGACTTCTTCAACGGGAAAGAACTGAATAAGAGCATCAACCCT
GATGAGGCTGTTGCATATGGTGCAGCTGTCCAGGCAGCCATTTTGTCTGGAGACAAATCTGAAAATGTTCAAGACTTGCTGCTGTTGGAT
GTCACTCCTCTTTCCCTTGGAATTGAAACTGCTGGTGGAGTCATGACTGTCCTCATCAAGCGCAATACTACCATTCCTACCAAGCAGACG
CAGACTTTCACCACCTACTCTGACAACCAGCCTGGTGTGCTCATTCAGGTTTATGAAGGTGAGCGTGCCATGACCAAGGATAACAACCTG
CTTGGCAAGTTTGAACTCACGGGCATACCTCCTGCCCCCCGTGGTGTTCCTCAGATTGAAGTCACTTTTGATATTGATGCCAATGGCATC
CTCAATGTTTCTGCTGTGGATAAGAGCACAGGAAAAGAGAACAAGATTACCATCACTAATGACAAGGGCCGCTTGAGCAAGGAAGACATT
GAACGCATGGTTCAAGAAGCAGAGAAGTACAAAGCTGAAGATGAGAAGCAGCGGGACAAGGTGTCTTCAAAGAATTCGCTTGAATCCTAC
GCCTTCAACATGAAAGCTACTGTTGAGGATGAGAAACTTCAGGGCAAGATTAATGATGAGGACAAACAGAAGATTCTTGACAAGTGTAAT
GAAATAATCAACTGGCTGGATAAGAACCAGACTGCAGAGAAGGAAGAATTTGAACATCAGCAGAAGGAGCTGGAAAAAGTCTGCAACCCC
ATCATTACCAAGCTGTACCAGAGTGCAGGAGGCATGCCTGGGGGAATGCCAGGAGGAATGCCTGGGGGCTTCCCTGGTGGTGGAGCTCCT
CCATCAGGTGGTGCCTCCTCTGGGCCCACCATTGAAGAGGTTGATTAAGCCAGCCTAGCATAGATTTAGCATTGTTCCACACAAAACATG
GAAGGACCCAAATTGTAGCAAATTCCGTGGCAGTTACGAAGTTGAGCTGCTATAGTAAATAAACTGGGCATTCTTGATACTTGAACATGG
AATGTGTGTGCACATGGAAAAACATTGCACTTTACAAGCACTGTATTGTAAGTGGAAAAATGCAATGTCTTAAATAAAATTGTATTTAAA
ATTGCCAAAAAAAAAAAAAAAA

Gene Information
Molecule Type mRNA
Bases 2272 Bases
Molecular Weight703355.6 Da
Coding Sequence 76..2028
NCBI ReferenceNM_174345
Notes Bos taurus heat shock 70kDa protein 8 (HSPA8); mRNA. heatshockcognate71kDaprotein

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 6 to 389 384 N-terminal nucleotide/ATP binding domain PF00012
Linker 390 to 396 7 Linker region Manually identified
Substrate Binding Domain 397 to 612 216 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 511 to 536 26 Coiled coil region Manually identified

Graphical View

STRUCTURE   hide


ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_BOTA4

Accession Number

HSP70_1243

Added on

2012-02-02

Updated On

2014-01-20