Help  Custom Search
 
heat shock 70 (HSP70) protein of Cryptosporidium parvum Iowa II

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock 70 (HSP70) protein

Synonymous Names

Q5CPP8_CRYPV, HSP70

Taxon Information

Organism

Cryptosporidium parvum Iowa II

Organism ID

353152 [NCBI] [UNIPROT]

Lineage

Eukaryota; Alveolata; Apicomplexa; Coccidia; Eucoccidiorida; Eimeriorina; Cryptosporidiidae; Cryptosporidium; Cryptosporidium parvum Iowa II

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
ILIEIQKNKMTSSEGPAIGIDLGTTYSCVGVWRNDTVDIVPNDQGNRTTPSYVAFTETERLIGDAAKNQV ARNPENTVFDAKRLIGRKFDDQAVQSDMTHWPFKVVRGPKDKPIISVNYLGEKKEFHAEEISAMVLQKMK EISEAYLGRQIKNAVVTVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAAIAYGLDKKGTGERNVLIF DLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVEFCVQDFKRKNRGMDLTTNARALRRLRTQC ERAKRTLSSSTQATIELDSLYEGIDYSVAISRARFEELCADYFRATLAPVEKVLKDAGMDKRSVHDVVLV GGSTRIPKVQALIQEFFNGKEPCKAINPDEAVAYGAAVQAAILNGEQSSAVQDLLLLDVAPLSLGLETAG GVMTKLIERNTTIPAKKTQVFTTYADNQSGVLIQVYEGERAMTKDNHLLGKFHLDGIPPAPRGVPQIEVT FDIDANGILNVSAVDKSTGKSSKITITNDKGRLSKDDIERMVNDAEKYKGEDEQNRLKIEAKNSLENYLY NMRNTIQEPKVKEKLSQSEIDEAEKKIKDALDWLEHNQTAEKDEFEHQQKEIETHMNPLMMKIYSAEGGM PGGMPGGMPGGMPGGMPGGMPGGMPGGMPGGMPGGMPGGMPGSNGPTVEEVD

FASTA Format Composition Secondary Structure

Nucleotide
 ATTCTTATCGAAATTCAAAAAAACAAGATGACATCATCTGAAGGTCCAGCTATTGGTATTGATTTAGGTACCACATACTCATGTGTTGG
TGTATGGAGAAACGATACTGTAGATATTGTTCCAAACGATCAAGGTAACCGTACAACACCATCATATGTAGCATTTACAGAAACTGAGCG
TCTTATTGGTGATGCAGCAAAGAACCAAGTTGCTAGAAACCCAGAAAATACAGTTTTTGATGCTAAACGTCTTATTGGTAGAAAGTTTGA
TGATCAGGCAGTACAAAGTGATATGACTCACTGGCCATTTAAAGTAGTTAGAGGTCCAAAGGACAAGCCAATCATCAGTGTAAACTACTT
AGGTGAAAAGAAGGAATTCCATGCTGAAGAAATTTCTGCTATGGTTTTACAAAAGATGAAGGAGATCTCTGAAGCATACTTGGGTCGCCA
AATTAAGAACGCTGTAGTTACTGTTCCAGCTTATTTCAATGACTCACAGCGTCAAGCAACAAAGGATGCAGGTGCAATTGCTGGTTTGAA
TGTAATGAGAATCATTAACGAGCCAACTGCAGCTGCTATTGCTTATGGTCTTGATAAGAAAGGAACTGGCGAGAGAAATGTATTGATCTT
CGATTTAGGTGGTGGTACTTTTGATGTATCATTATTAACTATTGAAGATGGTATTTTTGAAGTTAAAGCTACCGCTGGTGATACTCACTT
GGGTGGTGAAGATTTTGATAACAGACTCGTAGAATTCTGTGTACAAGATTTCAAGAGAAAGAATAGAGGTATGGATTTAACCACAAATGC
TAGAGCTTTAAGAAGACTCAGAACTCAATGCGAGCGTGCAAAGAGAACTTTGTCATCTTCTACTCAAGCTACAATTGAGTTAGATTCACT
CTATGAAGGTATTGATTATTCAGTTGCCATCAGTAGAGCTAGATTCGAAGAACTCTGCGCTGATTACTTCCGTGCAACTTTAGCTCCAGT
TGAGAAAGTACTCAAGGATGCTGGTATGGACAAGAGATCTGTACATGATGTTGTATTGGTTGGTGGTTCTACACGTATTCCAAAGGTTCA
GGCCTTGATTCAGGAATTCTTTAACGGTAAAGAGCCATGCAAAGCAATCAATCCAGACGAAGCTGTTGCTTATGGTGCTGCTGTACAAGC
TGCTATCTTAAATGGTGAGCAATCCTCTGCCGTACAGGATCTCTTATTATTGGATGTTGCTCCATTATCACTCGGTTTAGAAACTGCTGG
TGGTGTTATGACCAAGCTTATTGAACGTAATACAACTATCCCAGCAAAGAAGACACAAGTCTTCACTACTTATGCTGATAACCAGAGTGG
TGTCTTGATCCAAGTTTATGAGGGTGAGAGAGCCATGACTAAGGATAACCATCTCCTCGGAAAGTTCCATCTTGATGGTATTCCACCAGC
ACCAAGAGGTGTACCACAAATTGAAGTCACCTTTGATATTGATGCTAATGGTATCTTGAATGTGTCTGCTGTTGATAAGAGTACTGGTAA
GAGCAGCAAGATCACTATTACTAACGATAAGGGTAGATTATCAAAGGACGATATTGAACGTATGGTTAATGATGCTGAGAAATACAAGGG
TGAGGATGAGCAGAACAGACTTAAGATTGAGGCTAAGAACTCTTTGGAGAACTACCTCTATAACATGAGGAACACCATCCAAGAACCAAA
GGTTAAGGAAAAGCTTTCTCAATCTGAAATTGATGAGGCTGAGAAGAAGATCAAGGATGCTCTTGACTGGCTCGAGCACAACCAAACTGC
TGAAAAGGACGAGTTTGAACATCAACAAAAGGAGATTGAAACTCATATGAATCCACTCATGATGAAGATCTACTCTGCTGAGGGTGGTAT
GCCAGGTGGAATGCCAGGTGGTATGCCAGGCGGTATGCCAGGTGGAATGCCAGGTGGTATGCCAGGTGGAATGCCAGGCGGTATGCCAGG
TGGTATGCCAGGTGGTATGCCAGGTGGTATGCCAGGATCTAATGGTCCAACTGTTGAAGAGGTCGACTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine64532 %
Guanine48824 %
Thyamine56128 %
Cytosine35518 %
A+T120659 %
G+C84342 %

Total Bases :   2049 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA1623
GAGAGA60923
GGTGGTGGT63633
GAGAGA137423
AGAAGAAGA175033

Microsatellite Map

ATTCTTATCGAAATTCAAAAAAACAAGATGACATCATCTGAAGGTCCAGCTATTGGTATTGATTTAGGTACCACATACTCATGTGTTGGT
GTATGGAGAAACGATACTGTAGATATTGTTCCAAACGATCAAGGTAACCGTACAACACCATCATATGTAGCATTTACAGAAACTGAGCGT
CTTATTGGTGATGCAGCAAAGAACCAAGTTGCTAGAAACCCAGAAAATACAGTTTTTGATGCTAAACGTCTTATTGGTAGAAAGTTTGAT
GATCAGGCAGTACAAAGTGATATGACTCACTGGCCATTTAAAGTAGTTAGAGGTCCAAAGGACAAGCCAATCATCAGTGTAAACTACTTA
GGTGAAAAGAAGGAATTCCATGCTGAAGAAATTTCTGCTATGGTTTTACAAAAGATGAAGGAGATCTCTGAAGCATACTTGGGTCGCCAA
ATTAAGAACGCTGTAGTTACTGTTCCAGCTTATTTCAATGACTCACAGCGTCAAGCAACAAAGGATGCAGGTGCAATTGCTGGTTTGAAT
GTAATGAGAATCATTAACGAGCCAACTGCAGCTGCTATTGCTTATGGTCTTGATAAGAAAGGAACTGGCGAGAGAAATGTATTGATCTTC
GATTTAGGTGGTGGTACTTTTGATGTATCATTATTAACTATTGAAGATGGTATTTTTGAAGTTAAAGCTACCGCTGGTGATACTCACTTG
GGTGGTGAAGATTTTGATAACAGACTCGTAGAATTCTGTGTACAAGATTTCAAGAGAAAGAATAGAGGTATGGATTTAACCACAAATGCT
AGAGCTTTAAGAAGACTCAGAACTCAATGCGAGCGTGCAAAGAGAACTTTGTCATCTTCTACTCAAGCTACAATTGAGTTAGATTCACTC
TATGAAGGTATTGATTATTCAGTTGCCATCAGTAGAGCTAGATTCGAAGAACTCTGCGCTGATTACTTCCGTGCAACTTTAGCTCCAGTT
GAGAAAGTACTCAAGGATGCTGGTATGGACAAGAGATCTGTACATGATGTTGTATTGGTTGGTGGTTCTACACGTATTCCAAAGGTTCAG
GCCTTGATTCAGGAATTCTTTAACGGTAAAGAGCCATGCAAAGCAATCAATCCAGACGAAGCTGTTGCTTATGGTGCTGCTGTACAAGCT
GCTATCTTAAATGGTGAGCAATCCTCTGCCGTACAGGATCTCTTATTATTGGATGTTGCTCCATTATCACTCGGTTTAGAAACTGCTGGT
GGTGTTATGACCAAGCTTATTGAACGTAATACAACTATCCCAGCAAAGAAGACACAAGTCTTCACTACTTATGCTGATAACCAGAGTGGT
GTCTTGATCCAAGTTTATGAGGGTGAGAGAGCCATGACTAAGGATAACCATCTCCTCGGAAAGTTCCATCTTGATGGTATTCCACCAGCA
CCAAGAGGTGTACCACAAATTGAAGTCACCTTTGATATTGATGCTAATGGTATCTTGAATGTGTCTGCTGTTGATAAGAGTACTGGTAAG
AGCAGCAAGATCACTATTACTAACGATAAGGGTAGATTATCAAAGGACGATATTGAACGTATGGTTAATGATGCTGAGAAATACAAGGGT
GAGGATGAGCAGAACAGACTTAAGATTGAGGCTAAGAACTCTTTGGAGAACTACCTCTATAACATGAGGAACACCATCCAAGAACCAAAG
GTTAAGGAAAAGCTTTCTCAATCTGAAATTGATGAGGCTGAGAAGAAGATCAAGGATGCTCTTGACTGGCTCGAGCACAACCAAACTGCT
GAAAAGGACGAGTTTGAACATCAACAAAAGGAGATTGAAACTCATATGAATCCACTCATGATGAAGATCTACTCTGCTGAGGGTGGTATG
CCAGGTGGAATGCCAGGTGGTATGCCAGGCGGTATGCCAGGTGGAATGCCAGGTGGTATGCCAGGTGGAATGCCAGGCGGTATGCCAGGT
GGTATGCCAGGTGGTATGCCAGGTGGTATGCCAGGATCTAATGGTCCAACTGTTGAAGAGGTCGACTAA

Gene Information
Molecule Type mRNA
Bases 2049 Bases
Molecular Weight635928.07 Da
Coding Sequence01/01/49
NCBI ReferenceXM_625373
Notes Cryptosporidium parvum Iowa II heat shock 70 (HSP70) protein(cgd2_20) mRNA; partial cds. heatshock70(HSP70)protein

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 17 to 402 386 N-terminal nucleotide/ATP binding domain PF00012
Linker 403 to 409 7 Linker region Manually identified
Substrate Binding Domain 410 to 625 216 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 273 to 293 21 Coiled coil region Manually identified

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

3KVG Jmol
3L4I Jmol
3L6Q Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_CRPR1

Accession Number

HSP70_0371

Added on

2012-02-02

Updated On

2014-01-20