Help  Custom Search
 
HSP70 family molecular chaperone of Agrobacterium tumefaciens str. C58

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

HSP70 family molecular chaperone

Synonymous Names

Q7D073_AGRT5, Heat shock protein 70, Heat shock 70 kDa protein, HSP70

Taxon Information

Organism

Agrobacterium tumefaciens str. C58

Organism ID

176299 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium tumefaciens str. C58

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MTQKRALGLDFGTTNTVMALSDTGSASHSMRFTSSAGTDDSMRTALSFMKDAGLGAAALHVEAGQAAIRQ FIDNAGDCRFLQSIKTFAASPLFQGTLIFAKRQSFEDLMEVFLRKLKTYAGSEWPGDVSTVIAGRPVRFA GSNPDETLALARYNEALTRAGFPEIHYVYEPVAAAYYFAQSLKKDANVLVADFGGGTTDYSLIRFETHAG KLSATPIGHSGVGVAGDHFDFRMIDNLVSPEIGKGSKFKSFDKVLDVPSGYYVNFGRWNQLSIFKTSKEF TDLKSLVRSALEPDKLELFIDLVEHDEGYPLYQAISATKMALSSAQEAEFNFSPLGKAGRKMVKRSDFNN WIADDLAKIEGALDEVLEKTKVAPEAIDKVFLTGGTSFVPAVRELFTRRFDADRIESGGELLSIAHGLAM IGESGDIQRWTA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGACGCAAAAGCGGGCTCTCGGCCTCGATTTCGGCACGACCAACACGGTCATGGCTCTTTCCGACACTGGCAGCGCAAGCCATTCCAT
GCGCTTCACCAGCAGCGCGGGCACGGATGACAGCATGCGCACGGCGCTCTCTTTCATGAAGGATGCCGGCCTGGGTGCGGCCGCCCTGCA
TGTGGAGGCGGGACAAGCCGCCATCCGGCAATTCATCGACAATGCCGGCGACTGTCGTTTCCTGCAGTCGATCAAGACATTTGCGGCCTC
GCCGCTGTTTCAGGGCACGCTGATCTTCGCCAAGCGCCAAAGCTTCGAAGACCTGATGGAGGTGTTCCTGCGCAAGCTGAAGACCTATGC
GGGATCCGAATGGCCGGGCGATGTGTCGACCGTCATCGCCGGCCGGCCGGTGCGTTTTGCCGGCAGCAATCCGGACGAAACGCTGGCGCT
TGCCCGTTACAACGAAGCGCTCACCCGGGCCGGTTTCCCGGAAATCCACTATGTCTATGAGCCGGTGGCGGCCGCCTATTATTTCGCCCA
GAGCCTGAAGAAGGACGCCAATGTGCTGGTGGCGGATTTCGGCGGTGGCACGACGGACTATTCGCTGATCCGGTTCGAAACCCATGCCGG
CAAGCTTTCCGCCACCCCCATCGGCCATTCCGGCGTCGGCGTGGCGGGCGATCATTTCGACTTCCGCATGATCGACAATCTGGTCTCGCC
TGAGATCGGCAAGGGCAGCAAGTTCAAAAGCTTCGACAAGGTGCTGGACGTGCCTTCCGGTTATTACGTGAACTTCGGCCGCTGGAACCA
GCTGTCGATCTTCAAGACCTCCAAGGAATTCACCGACCTCAAATCGCTGGTGCGCTCGGCGCTGGAGCCCGACAAGCTCGAACTCTTCAT
CGATCTCGTCGAGCATGACGAAGGTTACCCGCTCTATCAGGCGATCTCCGCCACCAAGATGGCGCTGTCGTCTGCCCAAGAGGCGGAATT
CAACTTCTCGCCGCTCGGCAAGGCCGGACGCAAGATGGTGAAACGCAGCGATTTCAACAACTGGATCGCCGACGATCTGGCCAAGATCGA
GGGTGCGCTGGACGAGGTTCTGGAGAAGACGAAAGTTGCACCAGAGGCGATCGACAAGGTGTTCCTCACCGGCGGTACCTCCTTCGTGCC
GGCGGTGCGGGAGCTTTTCACCCGCCGTTTCGACGCCGACCGGATCGAAAGCGGCGGCGAGTTGCTCTCGATCGCCCATGGTCTCGCCAT
GATCGGCGAAAGCGGCGATATTCAGCGCTGGACAGCGTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine25620 %
Guanine39131 %
Thyamine25220 %
Cytosine40031 %
A+T50840 %
G+C79161 %

Total Bases :   1299 bases

Microsatellites
SequencePosition LengthRepeats
CTCTCT13523
GCCGGCCGGCCG39643
GCGGCGGCG121933

Microsatellite Map

ATGACGCAAAAGCGGGCTCTCGGCCTCGATTTCGGCACGACCAACACGGTCATGGCTCTTTCCGACACTGGCAGCGCAAGCCATTCCATG
CGCTTCACCAGCAGCGCGGGCACGGATGACAGCATGCGCACGGCGCTCTCTTTCATGAAGGATGCCGGCCTGGGTGCGGCCGCCCTGCAT
GTGGAGGCGGGACAAGCCGCCATCCGGCAATTCATCGACAATGCCGGCGACTGTCGTTTCCTGCAGTCGATCAAGACATTTGCGGCCTCG
CCGCTGTTTCAGGGCACGCTGATCTTCGCCAAGCGCCAAAGCTTCGAAGACCTGATGGAGGTGTTCCTGCGCAAGCTGAAGACCTATGCG
GGATCCGAATGGCCGGGCGATGTGTCGACCGTCATCGCCGGCCGGCCGGTGCGTTTTGCCGGCAGCAATCCGGACGAAACGCTGGCGCTT
GCCCGTTACAACGAAGCGCTCACCCGGGCCGGTTTCCCGGAAATCCACTATGTCTATGAGCCGGTGGCGGCCGCCTATTATTTCGCCCAG
AGCCTGAAGAAGGACGCCAATGTGCTGGTGGCGGATTTCGGCGGTGGCACGACGGACTATTCGCTGATCCGGTTCGAAACCCATGCCGGC
AAGCTTTCCGCCACCCCCATCGGCCATTCCGGCGTCGGCGTGGCGGGCGATCATTTCGACTTCCGCATGATCGACAATCTGGTCTCGCCT
GAGATCGGCAAGGGCAGCAAGTTCAAAAGCTTCGACAAGGTGCTGGACGTGCCTTCCGGTTATTACGTGAACTTCGGCCGCTGGAACCAG
CTGTCGATCTTCAAGACCTCCAAGGAATTCACCGACCTCAAATCGCTGGTGCGCTCGGCGCTGGAGCCCGACAAGCTCGAACTCTTCATC
GATCTCGTCGAGCATGACGAAGGTTACCCGCTCTATCAGGCGATCTCCGCCACCAAGATGGCGCTGTCGTCTGCCCAAGAGGCGGAATTC
AACTTCTCGCCGCTCGGCAAGGCCGGACGCAAGATGGTGAAACGCAGCGATTTCAACAACTGGATCGCCGACGATCTGGCCAAGATCGAG
GGTGCGCTGGACGAGGTTCTGGAGAAGACGAAAGTTGCACCAGAGGCGATCGACAAGGTGTTCCTCACCGGCGGTACCTCCTTCGTGCCG
GCGGTGCGGGAGCTTTTCACCCGCCGTTTCGACGCCGACCGGATCGAAAGCGGCGGCGAGTTGCTCTCGATCGCCCATGGTCTCGCCATG
ATCGGCGAAAGCGGCGATATTCAGCGCTGGACAGCGTGA

Gene Information
Molecule Type genomic DNA
Bases 1299 Bases
Molecular Weight401171.31 Da
Coding Sequence complement(AE007869.2:983084..984382)
NCBI ReferenceAAK86797
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
HSP70 98 to 251 154 Hsp70 protein family PF00012
HSP70 287 to 424 138 Hsp70 protein family PF00012

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_AGTU2

Accession Number

HSP70_0025

Added on

2012-02-02

Updated On

2014-01-20