Help  Custom Search
 
molecular chaperone DnaK of Agrobacterium tumefaciens str. C58

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

molecular chaperone DnaK

Synonymous Names

DNAK_AGRT5, Chaperone protein dnaK, Heat shock protein 70, Heat shock 70 kDa protein, HSP70, DnaK

Gene names

Gene Name

dnaK

Gene Locus Tag

Atu0122

Gene Identifier

1132160

Taxon Information

Organism

Agrobacterium tumefaciens str. C58

Organism ID

176299 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium tumefaciens str. C58

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp70 Protein family

SEQUENCE INFORMATION

Sequence
MAKVIGIDLGTTNSCVAVMDGKDTKVIENAEGARTTPSMVAFSDDGERLVGQPAKRQAVTNPTNTLFAVK RLIGRRYEDPTVEKDKALVPFEIVKGDNGDAWVKAQDKNYSPSQISAMILQKMKETAESYLGEKVEKAVI TVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKEGKTIAVYDLGGGTFDISVLEIGDGV FEVKSTNGDTFLGGEDFDMRLVEYLAGEFKKDQGIDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPF ITADASGPKHLTLKLTRAKFESLVDDLVQRTVAPCKAALKDAGVTAAEIDEVVLVGGMSRMPKVQEVVKQ LFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQT FSTAEDNQSAVTIRVSQGEREMAQDNKLLGQFDLVGLPPSPRGVPQIEVTFDIDANGIVQVSAKDKGTGK EQQIRIQASGGLSDADIEKMVKDAEANAEADKKRRAGVEAKNQAESLIHSTEKSVKEYGDKVSETDRKAI EDAIASLKTAVEAAEPDADDIQAKTQTLMEVSMKLGQAIYEAQQAEAGDASAEGKDDVVDADYEEIKDDK KSA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAAAAGTAATCGGTATCGACCTTGGCACGACCAACTCCTGCGTCGCAGTGATGGATGGCAAGGACACGAAAGTAATTGAAAACGC
AGAAGGCGCGCGGACCACGCCGTCGATGGTGGCATTTTCCGACGATGGCGAACGCCTTGTCGGCCAGCCGGCCAAGCGCCAGGCAGTCAC
CAACCCGACCAACACCCTGTTTGCGGTCAAGCGCCTTATCGGCCGCCGTTATGAAGACCCGACCGTCGAGAAGGACAAGGCACTCGTCCC
CTTCGAAATCGTCAAGGGCGACAATGGCGACGCCTGGGTGAAGGCTCAGGACAAGAATTATTCCCCTTCGCAGATTTCCGCGATGATCCT
TCAAAAGATGAAGGAAACGGCTGAATCCTATCTCGGCGAAAAGGTCGAGAAGGCCGTCATCACCGTTCCGGCCTACTTTAACGACGCCCA
GCGTCAGGCCACCAAGGATGCCGGCCGCATCGCCGGTCTCGATGTTCTGCGTATCATCAACGAGCCGACGGCAGCAGCCCTCGCTTACGG
CCTCGACAAGAAGGAAGGCAAGACCATTGCCGTTTACGACCTTGGCGGCGGCACGTTCGATATTTCCGTTCTGGAAATCGGCGACGGCGT
CTTTGAAGTGAAGTCGACCAACGGTGATACCTTCCTCGGTGGTGAAGACTTCGACATGCGTCTGGTCGAATATCTGGCCGGCGAGTTCAA
GAAGGATCAGGGCATCGACCTGAAGAACGACAAGCTCGCTCTGCAGCGCCTCAAGGAAGCTGCCGAAAAGGCGAAGATCGAACTTTCGTC
CTCGCAGCAGACCGAAATCAACCTGCCGTTCATCACGGCTGATGCTTCCGGTCCGAAGCACCTGACGCCGAAGCTGACCCGCGCCAAGTT
CGAAAGCCTGGTTGACGATCTGGTGCAACGCACTGTCGCCCCTTGCAAGGCAGCACTGAAGGATGCCGGCGTTACCGCGGCCGAGATCGA
CGAAGTCGTTCTCGTCGGCGGCATGAGCCGCATGCCTAAGGTTCGGGAAGTCGTCAAGCAGCTGTTCGGCAAGGAGCCGCACAAGGGCGT
GAACCCGGATGAAGTGGTTGCCATGGGCGCCGCTATTCAGGCCGGCGTTCTGCAGGGCGACGTCAAGGACGTTCTGCTGCTCGACGTGAC
CCCGCTGTCGCTCGGCATCGAAACGCTGGGTGGCGTCTTCACGCGTCTGATCGATCGCAACACCACGATCCCGACGAAGAAGAGCCAGAC
CTTCTCGACTGCCGAAGACAACCAGTCGGCCGTGACCATCCGCGTTTCGCAGGGTGAGCGCGAAATGGCACAGGACAACAAGCTGCTCGG
CCAGTTCGACCTCGTCGGTCTGCCGCCGTCGCCACGCGCGGTTCCGCAGATCGAAGTGACCTTCGATATCGACGCCAACGGCATCGTGCA
GGTATCCGCCAAGGACAAGGGCACCGGCAAGGAGCAGCAGATCCGCATCCAGGCCTCCGGTGGTCTCTCCGACGCCGACATCGAAAAGAT
GGTGAAGGACGCCGAAGCCAATGCCGAGGCCGACAAGAAGCGTCGCGCCGGTGTCGAAGCCAAGAACCAGGCCGAAAGCCTCATTCACTC
CACCGAAAAGTCGGTGAAGGAATATGGCGACAAGGTTTCCGAGACCGACCGCAAGGCGATCGAAGACGCCATTGCCAGCCTGAAGACCGC
TGTCGAAGCCGCCGAGCCTGACGCAGACGACATTCAGGCCAAGACCCAGACCCTCATGGAAGTCTCCATGAAGCTTGGTCAGGCCATCTA
CGAAGCACAGCAGGCCGAGGCCGGTGATGCTTCCGCAGAAGGCAAGGATGACGTCGTCGATGCCGACTATGAAGAAATCAAGGACGACAA
GAAGTCCGCATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine45825 %
Guanine55830 %
Thyamine31617 %
Cytosine57030 %
A+T77441 %
G+C112860 %

Total Bases :   1902 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC9423
GGCGGCGGC58233
CGCGCG138323
TCTCTC150223

Microsatellite Map

ATGGCAAAAGTAATCGGTATCGACCTTGGCACGACCAACTCCTGCGTCGCAGTGATGGATGGCAAGGACACGAAAGTAATTGAAAACGCA
GAAGGCGCGCGGACCACGCCGTCGATGGTGGCATTTTCCGACGATGGCGAACGCCTTGTCGGCCAGCCGGCCAAGCGCCAGGCAGTCACC
AACCCGACCAACACCCTGTTTGCGGTCAAGCGCCTTATCGGCCGCCGTTATGAAGACCCGACCGTCGAGAAGGACAAGGCACTCGTCCCC
TTCGAAATCGTCAAGGGCGACAATGGCGACGCCTGGGTGAAGGCTCAGGACAAGAATTATTCCCCTTCGCAGATTTCCGCGATGATCCTT
CAAAAGATGAAGGAAACGGCTGAATCCTATCTCGGCGAAAAGGTCGAGAAGGCCGTCATCACCGTTCCGGCCTACTTTAACGACGCCCAG
CGTCAGGCCACCAAGGATGCCGGCCGCATCGCCGGTCTCGATGTTCTGCGTATCATCAACGAGCCGACGGCAGCAGCCCTCGCTTACGGC
CTCGACAAGAAGGAAGGCAAGACCATTGCCGTTTACGACCTTGGCGGCGGCACGTTCGATATTTCCGTTCTGGAAATCGGCGACGGCGTC
TTTGAAGTGAAGTCGACCAACGGTGATACCTTCCTCGGTGGTGAAGACTTCGACATGCGTCTGGTCGAATATCTGGCCGGCGAGTTCAAG
AAGGATCAGGGCATCGACCTGAAGAACGACAAGCTCGCTCTGCAGCGCCTCAAGGAAGCTGCCGAAAAGGCGAAGATCGAACTTTCGTCC
TCGCAGCAGACCGAAATCAACCTGCCGTTCATCACGGCTGATGCTTCCGGTCCGAAGCACCTGACGCCGAAGCTGACCCGCGCCAAGTTC
GAAAGCCTGGTTGACGATCTGGTGCAACGCACTGTCGCCCCTTGCAAGGCAGCACTGAAGGATGCCGGCGTTACCGCGGCCGAGATCGAC
GAAGTCGTTCTCGTCGGCGGCATGAGCCGCATGCCTAAGGTTCGGGAAGTCGTCAAGCAGCTGTTCGGCAAGGAGCCGCACAAGGGCGTG
AACCCGGATGAAGTGGTTGCCATGGGCGCCGCTATTCAGGCCGGCGTTCTGCAGGGCGACGTCAAGGACGTTCTGCTGCTCGACGTGACC
CCGCTGTCGCTCGGCATCGAAACGCTGGGTGGCGTCTTCACGCGTCTGATCGATCGCAACACCACGATCCCGACGAAGAAGAGCCAGACC
TTCTCGACTGCCGAAGACAACCAGTCGGCCGTGACCATCCGCGTTTCGCAGGGTGAGCGCGAAATGGCACAGGACAACAAGCTGCTCGGC
CAGTTCGACCTCGTCGGTCTGCCGCCGTCGCCACGCGCGGTTCCGCAGATCGAAGTGACCTTCGATATCGACGCCAACGGCATCGTGCAG
GTATCCGCCAAGGACAAGGGCACCGGCAAGGAGCAGCAGATCCGCATCCAGGCCTCCGGTGGTCTCTCCGACGCCGACATCGAAAAGATG
GTGAAGGACGCCGAAGCCAATGCCGAGGCCGACAAGAAGCGTCGCGCCGGTGTCGAAGCCAAGAACCAGGCCGAAAGCCTCATTCACTCC
ACCGAAAAGTCGGTGAAGGAATATGGCGACAAGGTTTCCGAGACCGACCGCAAGGCGATCGAAGACGCCATTGCCAGCCTGAAGACCGCT
GTCGAAGCCGCCGAGCCTGACGCAGACGACATTCAGGCCAAGACCCAGACCCTCATGGAAGTCTCCATGAAGCTTGGTCAGGCCATCTAC
GAAGCACAGCAGGCCGAGGCCGGTGATGCTTCCGCAGAAGGCAAGGATGACGTCGTCGATGCCGACTATGAAGAAATCAAGGACGACAAG
AAGTCCGCATAA

Gene Information
Molecule Type genomic DNA
Bases 1902 Bases
Molecular Weight588047.2 Da
Coding Sequence X87113.1:627..2528
NCBI ReferenceCAA60592
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Nucleotide Binding Domain 4 to 382 379 N-terminal nucleotide/ATP binding domain PF00012
Linker 383 to 389 7 Linker region Manually identified
Substrate Binding Domain 390 to 601 212 C-terminal substrate/peptide binding domain PF00012
Coiled Coil 247 to 274 28 Coiled coil region Manually identified
Coiled coil 511 to 531 21 Coiled coil region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP70_AGTU1

Accession Number

HSP70_0024

Added on

2012-02-02

Updated On

2014-01-20